KEGG   Monodelphis domestica (opossum): 100011114Help
Entry
100011114         CDS       T01031                                 

Definition
lysozyme C-like
Orthology
K13915  
lysozyme C [EC:3.2.1.17]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Salivary secretion
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Organismal Systems
  Digestive system
   04970 Salivary secretion
    100011114
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     100011114
Exosome [BR:mdo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100011114
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
8
AA seq 148 aa AA seqDB search
MKVLILLGLVFLPMLAHGKVYERCELARILKQNGMDGYRGISLANWVCLAKWESNYNTRV
TNYNSRDRSTDYGIFQINSRYWCNDGKTPRAVNACGISCRDLLTDNISKAITCAKRVVRD
PSGIRAWVAWRNRCQGKNLSSYIQGCRL
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtcctgattcttttgggtcttgtcttcctccccatgctagctcatggcaaggtc
tacgaaagatgtgaattggcaagaatcctgaagcaaaatgggatggatggctacagaggt
atcagcctggccaactgggtgtgcttggcaaaatgggaaagcaattataacacacgagtc
acaaactacaactctagagatcgaagcacagattatggaatatttcagatcaacagtcgc
tactggtgcaatgatgggaagacccctagagctgtgaatgcgtgtggcatctcatgtaga
gatcttttaacagataatatcagcaaagctataacctgtgcaaagagggttgtccgtgat
cccagtggcattcgggcatgggtggcatggagaaaccgttgccaaggaaagaatctttcc
tcttatatccaaggttgccgtctttag

DBGET integrated database retrieval system