KEGG   Monodelphis domestica (opossum): 100011161Help
Entry
100011161         CDS       T01031                                 

Gene name
G6PC
Definition
(RefSeq) glucose-6-phosphatase catalytic subunit
  KO
K01084  glucose-6-phosphatase [EC:3.1.3.9]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo00010  Glycolysis / Gluconeogenesis
mdo00052  Galactose metabolism
mdo00500  Starch and sucrose metabolism
mdo01100  Metabolic pathways
mdo04068  FoxO signaling pathway
mdo04151  PI3K-Akt signaling pathway
mdo04152  AMPK signaling pathway
mdo04910  Insulin signaling pathway
mdo04920  Adipocytokine signaling pathway
mdo04922  Glucagon signaling pathway
mdo04931  Insulin resistance
mdo04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100011161 (G6PC)
   00052 Galactose metabolism
    100011161 (G6PC)
   00500 Starch and sucrose metabolism
    100011161 (G6PC)
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    100011161 (G6PC)
   04151 PI3K-Akt signaling pathway
    100011161 (G6PC)
   04152 AMPK signaling pathway
    100011161 (G6PC)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100011161 (G6PC)
   04922 Glucagon signaling pathway
    100011161 (G6PC)
   04920 Adipocytokine signaling pathway
    100011161 (G6PC)
  Digestive system
   04973 Carbohydrate digestion and absorption
    100011161 (G6PC)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    100011161 (G6PC)
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     100011161 (G6PC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAP2 DUF373
Motif
Other DBs
NCBI-GeneID: 100011161
NCBI-ProteinID: XP_001364884
Position
2
AA seq 357 aa AA seqDB search
MEAGMNVLHDFGIQSTRYLQVNYKDSKDWFILVSMLADLRNAFYVLFPIWFHVREAVGIK
LLWVAVIGDWLNLVFKWILFGQRPYWWVLDTDYYINTSVPVIKQFPITCETGPGSPSGHA
MGAAGVYYVIVTSILSLTRGKKKPTFRFRCLHVLLWLGFWAVQLNVCLSRIYLAAHFPHQ
VVAGVFSGIAVAEMFRHIQSIYNASLKKYFVITFFLFSFAIGFYLMLKGLGIDLLWTLEK
AKRWCERPEWVHIDTTPFASLLKNLGTLFGLGLALNSNMYKESCKGKQNKQLPFRLCCIV
ASLIILHLFDTFKPPSQVEMLFYVLSFCKSAAVPLTSVSFIPYCFSRILGQSEKKFL
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggaggcagggatgaatgtcctccatgactttgggatccaatcgacccgttacctccaa
gtaaattataaagactccaaggactggttcatcttggtctcgatgcttgcagatctcagg
aatgccttctatgtcctctttcccatttggttccatgttcgagaggctgtaggcatcaaa
cttctctgggtggctgtgattggagactggctcaatttggtttttaagtggattcttttt
ggacagcgtccgtactggtgggtattagacactgactactacataaatacatctgtgcct
gtgataaagcagtttcccatcacctgtgagactggtccaggtagtccttcgggccatgcc
atgggtgcagcaggtgtatactatgtgattgtcacatccatcctctcccttactcgtgga
aaaaagaaaccaactttcaggttccggtgtctgcatgtgcttctgtggttggggttctgg
gctgtgcagctcaatgtctgtctgtcccgaatctatcttgctgcccatttccctcatcag
gttgttgctggagtcttctcaggtattgctgttgctgaaatgttccgccatatccagagc
atctacaatgccagtctcaagaagtattttgtgatcaccttcttcctgtttagctttgcc
attggattttacctgatgctgaagggattggggattgacctcctgtggacccttgagaaa
gccaagaggtggtgtgagaggccagaatgggtccatattgacaccaccccctttgccagt
ctgctcaagaaccttgggaccctttttggcctgggcctggccctcaactccaatatgtac
aaggaaagttgcaagggaaaacagaacaagcagctccccttccgcctgtgttgtatcgtg
gcctcgctgatcatcttgcatctttttgatactttcaaacccccatcccaggtggagatg
ctgttctacgtgctgtctttttgcaaaagtgcagcggtacctctgacatcggttagcttt
atcccttactgcttctcccggatcctgggccagtccgagaagaaatttttatag

DBGET integrated database retrieval system