KEGG   Monodelphis domestica (opossum): 100011386Help
Entry
100011386         CDS       T01031                                 

Gene name
CCNH
Definition
cyclin H
Orthology
K06634  
cyclin H
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Basal transcription factors
Nucleotide excision repair
Cell cycle
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    100011386 (CCNH)
  Replication and repair
   03420 Nucleotide excision repair
    100011386 (CCNH)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    100011386 (CCNH)
Transcription machinery [BR:mdo03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     100011386 (CCNH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 323 aa AA seqDB search
MYHNSSQKRHWTFSSEEQLGRLRADANRKFKCKVVANGKVLANDPVFLEPHEELIICKYY
EKRLLDFCSIFKPTMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNV
SSAQFVGNLRESPLGQEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYPI
LENPEVLRKTADDFLNRIALTDAYLLYTPSQIALTTILSSASRAGINMESYLSESLMLKE
NRTCLSQLLDTMKCMKNLVKKYEPPRPEEVAALKQKLEKCHSAELAFNINAKKRKGYEDD
EYVSKKSKLEEEEWTDDDLIDSL
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgtatcacaacagcagccagaagcggcactggacgttctccagtgaggagcagttgggg
cgcctccgggccgacgccaaccgcaagttcaagtgcaaagtggtggcgaacgggaaggtt
ttggcaaatgatccagtctttcttgagcctcatgaagaattgatcatctgcaaatattat
gaaaaaagactattagatttctgttccatatttaagcctacaatgccaagatctgtggtg
ggtacagcatgtatgtatttcaagcgtttttacctcaataactcagtgatggaatatcac
cctcggataataatgctcacttgtgcatttttggcatgtaaagtagatgaatttaatgtg
tccagtgcacaatttgttggaaatctaagagagagtcctcttggacaggaaaaggcactt
gaacaaattttggaatatgaactcttacttattcagcagcttaatttccaccttattgtg
cacaatccttaccggccatttgagggttttctcattgacttaaagactcgttatccaata
ctagaaaacccagaagttctaaggaaaacagccgatgactttctaaatagaattgctttg
acagatgcttaccttttatatacaccttcacagattgctctgactaccattttatccagt
gcttctagggctggaattaacatggaaagttatttatcagaaagtcttatgctgaaagag
aatcgaacctgtttgtcacagttattagatacaatgaaatgcatgaaaaacttagtaaag
aagtatgaaccaccaaggcctgaggaagttgctgccctcaaacagaaactagagaagtgt
cacagtgctgaacttgcatttaatataaatgcaaagaagaggaaaggttatgaagatgat
gagtatgtctcaaagaaatctaagctggaagaggaagaatggactgatgatgatcttata
gattctctgtaa

DBGET integrated database retrieval system