KEGG   Monodelphis domestica (opossum): 100011522Help
Entry
100011522         CDS       T01031                                 

Definition
(RefSeq) histone H2B type 2-E
  KO
K11252  histone H2B
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo05034  Alcoholism
mdo05203  Viral carcinogenesis
mdo05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100011522
  Immune diseases
   05322 Systemic lupus erythematosus
    100011522
  Substance dependence
   05034 Alcoholism
    100011522
Chromosome and associated proteins [BR:mdo03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    100011522
Exosome [BR:mdo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100011522
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like
Motif
Other DBs
NCBI-GeneID: 100011522
NCBI-ProteinID: XP_001362695
Ensembl: ENSMODG00000023584
UniProt: F6PX60
Position
2
AA seq 126 aa AA seqDB search
MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgccggaacccgccaagtctgctcctgccccgaaaaagggttctaagaaggcggtgacc
aaagcgcaaaagaaagatggcaagaagcgcaagcgtagtcgcaaggagagctactctatc
tacgtgtacaaggtgctgaagcaggtccacccggacacgggcatctcgtccaaggctatg
ggcatcatgaattctttcgtcaacgacatcttcgagcgcatcgccggcgaggcttcccgc
ctggcgcactacaacaagcgctccaccatcacttcccgggagatccagacggccgtgcgc
ctgctgctgcccggggaattggccaagcacgccgtttccgaaggtaccaaggctgttacc
aagtacaccagctccaagtag

DBGET integrated database retrieval system