KEGG   Monodelphis domestica (opossum): 100011610Help
Entry
100011610         CDS       T01031                                 

Definition
cytochrome P450 1B1-like
Orthology
K07410  
cytochrome P450, family 1, subfamily B, polypeptide 1 [EC:1.14.14.1]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Steroid hormone biosynthesis
Tryptophan metabolism
Metabolism of xenobiotics by cytochrome P450
Ovarian steroidogenesis
Chemical carcinogenesis
MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100011610
  Amino acid metabolism
   00380 Tryptophan metabolism
    100011610
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100011610
 Organismal Systems
  Endocrine system
   04913 Ovarian Steroidogenesis
    100011610
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    100011610
   05204 Chemical carcinogenesis
    100011610
Enzymes [BR:mdo01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100011610
Cytochrome P450 [BR:mdo00199]
 Cytochrome P450, animal type
  CYP1 family
   100011610
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 545 aa AA seqDB search
MATSRSSEETWLPGLLSTQQTTLLLLFSVLAVVHLGQWLLRRVRRTPWASCRPPGPFQWP
LIGNAVEVGSIPHLSFTRLARRYGDVFQIRLGNCPVVVLNGERAIRQALLQQGAAFASRP
PFASFQVVSNGRSLAFNKYSELWKVQRRVAHGTVRAFSTGQVRSRQVLEQHVLSETRELV
ELLVQGSAGGAFLNPGPLTVVAVANVMSAVCFGCRYSHSDEEFRELLSHNERFGRTVGAG
SLVDVLPWLQRFPNPVRTAFRDFQKLNQDFYSFVLDKFLKHKSSLQPGAPPRDMMDAFIH
TVGKEEENPGEVKPGLRLDTEYVPATVTDIFGASQDTLSTALQWLLILFIRYPKVQAQVQ
EELDRVVGRDRLPSLNDQPHLPYVMAFLYEAMRFSSFVPVTIPHATTIDTSVMGYHIPKD
TVVFINQWSVNHDPEKWQNPEDFNPARFLDKKGFIDKDLASGVMIFSMGKRRCIGEELSK
IQLFLFIAILAHQCNFLANPDEDPEMNFSYGLTIKPQSFTINVTLRESMELLDSTVQRLQ
EENNQ
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atggcaacaagccgaagtagcgaagaaacctggctgcccggtcttctgtccacacagcag
accaccctcctgcttctcttctccgtgctagccgttgtccacttgggccagtggcttcta
cggcgtgtccgtcgaaccccatgggctagctgccgcccccctggtccattccagtggccc
ctgatcggaaacgcggtggaggtgggcagcatccctcatctctccttcactcgcttggcc
cgccgctacggcgacgttttccagatccgtctgggcaactgcccggttgtggtgctgaat
ggcgagcgcgccattcgtcaggccttgttacaacagggtgctgccttcgctagccgccca
ccgttcgcctccttccaggtggtgtccaacggccgcagcttggctttcaacaaatattca
gagctctggaaggtgcaacggcgggtggcgcacggcacagtgcgcgcattctccactgga
caagtccgcagccgccaggtcttggagcagcacgtgctgagcgagacgcgggagctggtg
gaattgctggtgcaaggtagcgccgggggtgccttcctgaaccccgggcccctcactgtg
gtggccgtggccaatgtgatgagtgccgtgtgcttcggctgccgctacagccatagcgac
gaagagttccgtgagctgctgagccacaacgagcgcttcggtcgcacggtgggggccggc
agcttggtggatgtactgccctggcttcagcgcttccccaatcccgtgcgcactgctttc
cgcgacttccagaagcttaaccaagacttctacagcttcgttctcgacaagttcctgaaa
cataagagcagcctgcagcccggagccccacctcgggacatgatggacgccttcatccac
acagtggggaaggaagaagagaaccctggagaagtaaagcctgggctgcgcctggacacc
gagtacgtgccagccacagtcacagatattttcggggccagtcaggacacgctttccact
gcactacagtggcttctcatcttattcataaggtatcccaaagtgcaggcccaggtacag
gaagaattggatagagtggtggggcgtgatcgattgccctccttgaatgatcagcctcat
cttccttatgtcatggcttttctgtatgaagccatgcgcttcagtagctttgtgcctgtt
accatcccacatgccaccaccattgacacctcagtcatgggctatcacattcccaaagat
acagtggtgtttatcaaccagtggtcagttaatcatgacccagagaagtggcagaaccca
gaagacttcaatccagcccgattcctggacaaaaaaggattcattgacaaagacttggct
agtggggtcatgatattctcgatgggcaaacgtaggtgcattggggaagagctgtccaaa
atacagctgtttctcttcattgccattctagcacaccagtgcaatttccttgccaatcca
gatgaggatccagaaatgaattttagttacgggctaaccattaaaccacagtcattcaca
attaatgtcacattgagagaatctatggagctacttgatagtactgttcaaagactacaa
gaggaaaacaaccagtga

DBGET integrated database retrieval system