KEGG   Monodelphis domestica (opossum): 100011610Help
Entry
100011610         CDS       T01031                                 

Definition
cytochrome P450 1B1-like
Orthology
K07410  
cytochrome P450, family 1, subfamily B, polypeptide 1 [EC:1.14.14.1]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Steroid hormone biosynthesis
Tryptophan metabolism
Metabolism of xenobiotics by cytochrome P450
Ovarian steroidogenesis
Chemical carcinogenesis
MicroRNAs in cancer
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:mdo00140]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:mdo00380]
Metabolism; Xenobiotics biodegradation and metabolism; Metabolism of xenobiotics by cytochrome P450 [PATH:mdo00980]
Organismal Systems; Endocrine system; Ovarian Steroidogenesis [PATH:mdo04913]
Human Diseases; Cancers; MicroRNAs in cancer [PATH:mdo05206]
Human Diseases; Cancers; Chemical carcinogenesis [PATH:mdo05204]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 545 aa AA seqDB search
MATSRSSEETWLPGLLSTQQTTLLLLFSVLAVVHLGQWLLRRVRRTPWASCRPPGPFQWP
LIGNAVEVGSIPHLSFTRLARRYGDVFQIRLGNCPVVVLNGERAIRQALLQQGAAFASRP
PFASFQVVSNGRSLAFNKYSELWKVQRRVAHGTVRAFSTGQVRSRQVLEQHVLSETRELV
ELLVQGSAGGAFLNPGPLTVVAVANVMSAVCFGCRYSHSDEEFRELLSHNERFGRTVGAG
SLVDVLPWLQRFPNPVRTAFRDFQKLNQDFYSFVLDKFLKHKSSLQPGAPPRDMMDAFIH
TVGKEEENPGEVKPGLRLDTEYVPATVTDIFGASQDTLSTALQWLLILFIRYPKVQAQVQ
EELDRVVGRDRLPSLNDQPHLPYVMAFLYEAMRFSSFVPVTIPHATTIDTSVMGYHIPKD
TVVFINQWSVNHDPEKWQNPEDFNPARFLDKKGFIDKDLASGVMIFSMGKRRCIGEELSK
IQLFLFIAILAHQCNFLANPDEDPEMNFSYGLTIKPQSFTINVTLRESMELLDSTVQRLQ
EENNQ
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atggcaacaagccgaagtagcgaagaaacctggctgcccggtcttctgtccacacagcag
accaccctcctgcttctcttctccgtgctagccgttgtccacttgggccagtggcttcta
cggcgtgtccgtcgaaccccatgggctagctgccgcccccctggtccattccagtggccc
ctgatcggaaacgcggtggaggtgggcagcatccctcatctctccttcactcgcttggcc
cgccgctacggcgacgttttccagatccgtctgggcaactgcccggttgtggtgctgaat
ggcgagcgcgccattcgtcaggccttgttacaacagggtgctgccttcgctagccgccca
ccgttcgcctccttccaggtggtgtccaacggccgcagcttggctttcaacaaatattca
gagctctggaaggtgcaacggcgggtggcgcacggcacagtgcgcgcattctccactgga
caagtccgcagccgccaggtcttggagcagcacgtgctgagcgagacgcgggagctggtg
gaattgctggtgcaaggtagcgccgggggtgccttcctgaaccccgggcccctcactgtg
gtggccgtggccaatgtgatgagtgccgtgtgcttcggctgccgctacagccatagcgac
gaagagttccgtgagctgctgagccacaacgagcgcttcggtcgcacggtgggggccggc
agcttggtggatgtactgccctggcttcagcgcttccccaatcccgtgcgcactgctttc
cgcgacttccagaagcttaaccaagacttctacagcttcgttctcgacaagttcctgaaa
cataagagcagcctgcagcccggagccccacctcgggacatgatggacgccttcatccac
acagtggggaaggaagaagagaaccctggagaagtaaagcctgggctgcgcctggacacc
gagtacgtgccagccacagtcacagatattttcggggccagtcaggacacgctttccact
gcactacagtggcttctcatcttattcataaggtatcccaaagtgcaggcccaggtacag
gaagaattggatagagtggtggggcgtgatcgattgccctccttgaatgatcagcctcat
cttccttatgtcatggcttttctgtatgaagccatgcgcttcagtagctttgtgcctgtt
accatcccacatgccaccaccattgacacctcagtcatgggctatcacattcccaaagat
acagtggtgtttatcaaccagtggtcagttaatcatgacccagagaagtggcagaaccca
gaagacttcaatccagcccgattcctggacaaaaaaggattcattgacaaagacttggct
agtggggtcatgatattctcgatgggcaaacgtaggtgcattggggaagagctgtccaaa
atacagctgtttctcttcattgccattctagcacaccagtgcaatttccttgccaatcca
gatgaggatccagaaatgaattttagttacgggctaaccattaaaccacagtcattcaca
attaatgtcacattgagagaatctatggagctacttgatagtactgttcaaagactacaa
gaggaaaacaaccagtga

DBGET integrated database retrieval system