KEGG   Monodelphis domestica (opossum): 100011727Help
Entry
100011727         CDS       T01031                                 

Gene name
PDIA3
Definition
protein disulfide isomerase family A, member 3
Orthology
K08056  
protein disulfide isomerase family A, member 3 [EC:5.3.4.1]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Protein processing in endoplasmic reticulum
Antigen processing and presentation
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100011727 (PDIA3)
 Organismal Systems
  Immune system
   04612 Antigen processing and presentation
    100011727 (PDIA3)
Enzymes [BR:mdo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100011727 (PDIA3)
Exosome [BR:mdo04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100011727 (PDIA3)
  Exosomal proteins of colorectal cancer cells
   100011727 (PDIA3)
  Exosomal proteins of bladder cancer cells
   100011727 (PDIA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 506 aa AA seqDB search
MAVRRRLALLPGLALLLAAACPAADATSDVLELTDDNFERRVADTGSAGLMLVEFFAPWC
GHCKRLAPEYEAAATRLKGIVPLAKVDCTANSNTCNKYGVSGYPTLKIFRNGEESGAYDG
PRTADGIVSHLKKQAGPASVPLMSTEDFDKFISDKSAAVVGFFKDLFSDSHSEFLKAATN
LRENYRFAHTNVDALVKKYDTDGEGITLFRPAHLANKFEESSIPYTEEKITSGKIKKFIQ
ENIFGICPHMTEDNKDLLQGKDLLVAYYDVDYDMNAKGSNYWRNRVMMIAQKFLEAGQKL
NFAVASRKTFSHELSEFGLERTFGEVPVVAIKTAKGEKYVMQEEFSRDGKALERFLQNYF
DGNLRRYLKSEPIPENNDGPVKVVVAENFDEMVNSEKDVLIEFYAPWCGHCKNLEPKYKE
LGEKLSKDPNIVIAKMDATANDVPSPYEVRGFPTIYFSPANNKQNPRKYEGGREVSDFIS
YLQREATNPPVIQEEKPKKKKAEEDL
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atggccgtgcgccgccgcctcgctctgctcccgggtttggcgctgctcctggccgcggcc
tgcccggccgctgacgccacctccgatgtactagagctcacggacgacaacttcgagcgg
cgcgtggccgatacaggcagtgccggcctcatgctggtggagttcttcgcgccctggtgt
ggacattgtaagaggcttgccccagaatatgaagctgcagcaaccaggctaaaaggaatt
gttcctttagcaaaggttgactgtactgccaactcaaatacctgtaataaatatggagtc
agtggctatcctactctgaaaatatttagaaatggtgaagaatcaggtgcctatgatggc
cctcgaacagctgatggaattgtgagtcatctgaagaagcaggcaggacctgcctcagtt
cctctcatgagtacagaagattttgacaaattcattagtgataaaagcgctgctgtggtg
ggtttcttcaaagacttattcagtgattctcactctgagttcctaaaagcagccacaaac
ttgagggaaaactaccgctttgcacataccaatgttgatgctctggtgaagaagtatgat
actgatggagagggtatcactttgttccgacctgcacatctagctaacaaatttgaggaa
agcagtataccttacacagaggaaaagataactagtggcaaaattaaaaaatttatccag
gaaaacatttttggtatttgcccgcatatgactgaagacaacaaagacttactccagggc
aaagatctacttgtagcttactatgatgtggactatgacatgaatgctaaaggttccaac
tactggagaaacagagtaatgatgatagcccagaaattcttagaagctggacagaaactc
aactttgctgttgctagtcgaaaaactttcagccatgaactttctgaatttggcttggaa
agaacctttggagaggtgcctgttgttgctatcaaaaccgcgaaaggagagaaatatgtt
atgcaagaggagttctctcgtgatgggaaggcccttgagcggttcttgcagaattacttt
gatggcaacttgaggagatacttgaagtctgaacctatcccagagaataatgatggacct
gtaaaggtagtagtagctgagaactttgatgaaatggttaattctgaaaaagatgttctg
atagaattttatgccccctggtgtggtcactgcaaaaatctagaacccaagtacaaagaa
ttgggagaaaagctcagcaaagaccccaatattgtcatagcaaagatggatgctacagct
aatgatgtgccttctccatatgaagtcagaggctttcctactatctacttctctccagcc
aataataagcaaaatccacgaaaatatgaaggtggccgagaagttagtgactttattagc
tacctacaaagagaagctacaaatcctcctgtgattcaagaggaaaaacccaaaaagaag
aaggcagaggaagatctttaa

DBGET integrated database retrieval system