KEGG   Monodelphis domestica (opossum): 100011791Help
Entry
100011791         CDS       T01031                                 

Gene name
TYMP
Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Pyrimidine metabolism
Drug metabolism - other enzymes
Metabolic pathways
Bladder cancer
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    100011791 (TYMP)
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    100011791 (TYMP)
 Human Diseases
  Cancers
   05219 Bladder cancer
    100011791 (TYMP)
Enzymes [BR:mdo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     100011791 (TYMP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
8
AA seq 451 aa AA seqDB search
MGGGKGLKPGWTGSTFPFSSWQSPRMAATQQTGPGSIPEMIKKKRDGARLEEAEIRSFVQ
GLTEGTVQEAQIGAMLMAIRLQGMDLGETETLTRALAESGQHLQWPEAWGGLLVDKHSTG
GVGDKVSLVLAPALAACGCKVPMISGRGLGHTGGTLDKLEAIPGFSVVQSPEQIQELLEH
VGCCIVGQSQELVPADGILYAIRDVTATVDSLPLITASILSKKAVERLSTLVVDVKFGEA
AIFPNQERARELAQALVGVGARLGIRVAAALTTMDSPLGHCVGHGLEVEEALQCLEGGGP
TDLRDLITQLGGSLLWLNGQAATLTQGVAQLGAMLDNGSALGRFQAMLEAQGVASDLAQA
LCSGSPAQRQGLLPTAPFKEELRAASEGTVQMIQALPLAQVLHELGAGRNRAGEPLHHDV
GLELLVSIGQRLSAGEALGVGVGAAEDLFFL
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atggggggaggcaaagggttgaagcctggctggacaggctccacttttcccttttcctcc
tggcagagtccaaggatggcagcaacccaacagacggggccaggctccatcccggagatg
attaagaagaagagagatggagctcgcctggaggaagcagagatccggagctttgttcaa
gggctgactgagggcacagtgcaggaggcgcagataggtgccatgttaatggccatccga
ctacaaggcatggacctgggcgagacagagactctgactcgagccctggcggagtctgga
cagcatctgcagtggcctgaagcctggggagggctgctggtggacaagcactcgacaggg
ggcgtgggggacaaagtcagcctggtcttggcacctgctctggccgcctgcggctgcaag
gtcccaatgatcagtgggcggggacttgggcacaccgggggcaccttggacaagctggag
gccatcccaggcttctcggtggtacaaagtccagagcagattcaggagctgctggagcat
gtaggctgctgcatcgtggggcagagtcaggagctggtccctgcagatggaatcctttat
gccattcgggatgtgactgccacagtggacagcctccctctgatcacagcctccatcctc
agcaagaaggctgtggagcgactctcaaccctggtggtggatgtgaagtttggagaggct
gccatcttcccaaaccaagaaagggcccgagagttggcccaggccctggtgggtgtaggg
gcccgactggggatccgggtggcagctgcgttgaccaccatggatagccctctgggccac
tgtgtgggccatgggcttgaagtagaggaggccttacagtgcctggaaggaggaggcccc
acagacttacgggacctcatcacccagctaggaggatctctgctgtggctgaatggccaa
gccgcaaccctaacccagggggtagcccagctgggtgccatgctggacaatggctctgcc
ttgggccggtttcaggccatgctggaggcccagggagtggcctctgacctggcccaagcc
ctgtgctcaggatctcctgcccagcgccaaggcctgctccccacagcccccttcaaggaa
gagctgagggcagcttccgagggcaccgtgcagatgatccaggccctgcccctggcccag
gtcctccatgagctgggggctggccggaaccgagcaggggagcccctccaccatgatgtc
gggctggagctgctggtgagcataggacagagactcagtgcaggtgaggctctaggggtg
ggagtgggggctgcagaagacctcttcttcctctga

DBGET integrated database retrieval system