KEGG   Monodelphis domestica (opossum): 100012056Help
Entry
100012056         CDS       T01031                                 

Definition
1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase zeta-1-like
Orthology
K05861  
phosphatidylinositol phospholipase C, zeta [EC:3.1.4.11]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Oocyte meiosis
Thyroid hormone signaling pathway
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:mdo00562]
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:mdo04020]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:mdo04070]
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:mdo04114]
Organismal Systems; Endocrine system; Thyroid hormone signaling pathway [PATH:mdo04919]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
8
AA seq 694 aa AA seqDB search
MRGAENSETSPMDQVVKRLRGDVRDSCAVSAEAGSFQQSHVHVERKLIRSGLEDKPWKAP
MSEARWFLSIIQEDFRAGRISLEKTVKLLEKLNIRCDGNHVKNVFKENDKQKNGKITIED
FRAIYRSFAYREDIVEIFNVYSRNHKILSEQNLMEFLKKEQYVLEIDKVIANEIIQKYEP
IEEVKNQHQMTIEGFLRYMNSNDCLLFKKNCTQVYHDMTRPLSDYFISSSHNTYLISGQL
IGPSDLWGYASALVKGCRCIEIDCWDGSQNEPVVYHGYTLTSKILFKTVIQVINKYAFMA
SEYPVVLSLENHCSPQQQEIMANNMQSILGDTLLSDVLENFPNELPSPEALKFKILVKNK
KIGTIEETIERIGTNKQGRIVEYEEEEDEEESEEKDNVTTPMLKENKEKELEEKKSIISN
FISYSKKKKIRKVKLSLELSDLVIYTKAEKFKSFHHAQINQKFNENNSIGELRARKLSKQ
KAREFISHTNSFITRIYPKATRTDSSNYIPQEFWNVGCQMVALNFQTPGVPMDLYNGKFL
DNGGCGYLLKPEILRNPKLNFSPSEFKHYNPTILSIRLISGFQLPSTYWNNSLVLIEIYG
IPDDQTKQQTHVIRRNAFDPRWNETFTFTIHAPEMALIRFVAESQSTIGANEFLGQYTLP
LLCMEKGYRTIPLFSKSGDSLDPASLFVYVWYHS
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
atgcgtggagctgagaactccgagacatcccccatggaccaggtggttaagagattaagg
ggagatgtgcgggacagctgtgctgtgtcagctgaagctggcagctttcagcaaagtcat
gtccacgtggagaggaaactcattagaagtggactagaagataaaccatggaaagctcca
atgtctgaggccagatggttcttatctattatacaggaggactttagagctggaagaatc
agccttgaaaaaacggtgaaattacttgaaaagctaaatatccggtgtgatggtaatcat
gtcaaaaatgtatttaaggaaaatgacaaacagaagaatggaaaaataaccatagaagat
tttagagcaatttatcggagttttgcttacagagaagatattgttgagattttcaatgtt
tattctcgaaatcacaaaattctgtctgaacaaaatctgatggaatttcttaaaaaagaa
caatatgtgcttgagatagataaagtcattgccaatgaaataattcaaaaatatgaaccc
attgaagaagtgaaaaatcaacaccagatgacaattgaaggatttttaagatacatgaac
tcaaatgattgcttactatttaaaaagaattgtacccaagtttatcatgatatgactcgt
cctttaagtgattactttatttcatcttctcataacacctacctgatttctgggcaatta
atagggccaagtgacctttggggctatgcaagtgcccttgtgaaaggatgtcgttgtata
gaaattgactgctgggatggatcacaaaatgaacctgttgtatatcatgggtatacacta
acaagcaagattctgtttaaaactgtcatccaggtgatcaacaagtatgcatttatggca
tctgaatacccagtagtactctctttagaaaatcactgctccccccagcaacaagaaata
atggcaaataatatgcaaagtattcttggggatacactgctttctgatgtacttgaaaat
tttccaaatgaattaccttcacctgaggcattgaaattcaaaatactagtaaaaaataag
aaaattggaacaatagaggagacaattgaaagaataggcactaacaaacaaggccggata
gtagaatatgaagaagaggaagatgaggaagagtctgaagaaaaagacaatgttactaca
cctatgcttaaagagaacaaagaaaaagaactagaagaaaaaaaatctataataagcaat
ttcatttcttattctaagaaaaaaaagattaggaaggtgaaattatccttggagctgtca
gatcttgtcatttacaccaaagctgagaaattcaagagctttcatcatgcccaaattaat
cagaaattcaatgagaataattctattggggagttgcgtgcaagaaaactttccaaacag
aaagctcgtgaatttatctcacatactaacagtttcattacgagaatatatccaaaggca
accagaacggattcttctaattacattcctcaagaattttggaatgtaggatgtcagatg
gtggccttaaatttccaaacccctggagtgcctatggatctgtacaatggaaaatttcta
gataatggtggctgtggatatcttttaaaaccagaaatcctaagaaatccaaaattaaac
ttctctccaagtgaatttaaacattataatccaactatactttcaataaggctcataagt
ggtttccagttgccatctacttattggaataattcactagtgttgatagaaatatatggc
attccagatgaccaaacaaagcaacagactcacgtaattagaagaaatgcttttgatcca
cgatggaatgaaacattcacatttactatccatgccccagaaatggcactcatacgcttt
gttgctgaaagtcagtctacaataggtgcaaatgaattccttggacagtacacgttacca
ctgctatgcatggaaaaaggttatcgcaccattcctctgttttccaaatcaggtgacagt
cttgatcctgcttcactatttgtttatgtgtggtatcattcatag

DBGET integrated database retrieval system