KEGG   Monodelphis domestica (opossum): 100012056Help
Entry
100012056         CDS       T01031                                 

Gene name
PLCZ1
Definition
phospholipase C, zeta 1
Orthology
K05861  
phosphatidylinositol phospholipase C, zeta [EC:3.1.4.11]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Oocyte meiosis
Thyroid hormone signaling pathway
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100012056 (PLCZ1)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    100012056 (PLCZ1)
   04070 Phosphatidylinositol signaling system
    100012056 (PLCZ1)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    100012056 (PLCZ1)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    100012056 (PLCZ1)
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100012056 (PLCZ1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
8
AA seq 644 aa AA seqDB search
MENRWFLSIIQEDFRAGRISLEKTVKLLEKLNIRCDGNHVKNVFKENDKQKNGKITIEDF
RAIYRSFAYREDIVEIFNVYSRNHKILSEQNLMEFLKKEQYVLEIDKVIANEIIQKYEPI
EEVKNQHQMTIEGFLRYMNSNDCLLFKKNCTQVYHDMTRPLSDYFISSSHNTYLISGQLI
GPSDLWGYASALVKGCRCIEIDCWDGSQNEPVVYHGYTLTSKILFKTVIQVINKYAFMAS
EYPVVLSLENHCSPQQQEIMANNMQSILGDTLLSDVLENFPNELPSPEALKFKILVKNKK
IGTIEETIERIGTNKQGRIVEYEEEEDEEESEEKDNVTTPMLKENKEKELEEKKSIISNF
ISYSKKKKIRKVKLSLELSDLVIYTKAEKFKSFHHAQINQKFNENNSIGELRARKLSKQK
AREFISHTNSFITRIYPKATRTDSSNYIPQEFWNVGCQMVALNFQTPGVPMDLYNGKFLD
NGGCGYLLKPEILRNPKLNFSPSEFKHYNPTILSIRLISGFQLPSTYWNNSLVLIEIYGI
PDDQTKQQTHVIRRNAFDPRWNETFTFTIHAPEMALIRFVAESQSTIGANEFLGQYTLPL
LCMEKDKFLLSAMMSFHYFSLPFKKASQESLTIPLCTYCFTVGA
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atggagaacagatggttcttatctattatacaggaggactttagagctggaagaatcagc
cttgaaaaaacggtgaaattacttgaaaagctaaatatccggtgtgatggtaatcatgtc
aaaaatgtatttaaggaaaatgacaaacagaagaatggaaaaataaccatagaagatttt
agagcaatttatcggagttttgcttacagagaagatattgttgagattttcaatgtttat
tctcgaaatcacaaaattctgtctgaacaaaatctgatggaatttcttaaaaaagaacaa
tatgtgcttgagatagataaagtcattgccaatgaaataattcaaaaatatgaacccatt
gaagaagtgaaaaatcaacaccagatgacaattgaaggatttttaagatacatgaactca
aatgattgcttactatttaaaaagaattgtacccaagtttatcatgatatgactcgtcct
ttaagtgattactttatttcatcttctcataacacctacctgatttctgggcaattaata
gggccaagtgacctttggggctatgcaagtgcccttgtgaaaggatgtcgttgtatagaa
attgactgctgggatggatcacaaaatgaacctgttgtatatcatgggtatacactaaca
agcaagattctgtttaaaactgtcatccaggtgatcaacaagtatgcatttatggcatct
gaatacccagtagtactctctttagaaaatcactgctccccccagcaacaagaaataatg
gcaaataatatgcaaagtattcttggggatacactgctttctgatgtacttgaaaatttt
ccaaatgaattaccttcacctgaggcattgaaattcaaaatactagtaaaaaataagaaa
attggaacaatagaggagacaattgaaagaataggcactaacaaacaaggccggatagta
gaatatgaagaagaggaagatgaggaagagtctgaagaaaaagacaatgttactacacct
atgcttaaagagaacaaagaaaaagaactagaagaaaaaaaatctataataagcaatttc
atttcttattctaagaaaaaaaagattaggaaggtgaaattatccttggagctgtcagat
cttgtcatttacaccaaagctgagaaattcaagagctttcatcatgcccaaattaatcag
aaattcaatgagaataattctattggggagttgcgtgcaagaaaactttccaaacagaaa
gctcgtgaatttatctcacatactaacagtttcattacgagaatatatccaaaggcaacc
agaacggattcttctaattacattcctcaagaattttggaatgtaggatgtcagatggtg
gccttaaatttccaaacccctggagtgcctatggatctgtacaatggaaaatttctagat
aatggtggctgtggatatcttttaaaaccagaaatcctaagaaatccaaaattaaacttc
tctccaagtgaatttaaacattataatccaactatactttcaataaggctcataagtggt
ttccagttgccatctacttattggaataattcactagtgttgatagaaatatatggcatt
ccagatgaccaaacaaagcaacagactcacgtaattagaagaaatgcttttgatccacga
tggaatgaaacattcacatttactatccatgccccagaaatggcactcatacgctttgtt
gctgaaagtcagtctacaataggtgcaaatgaattccttggacagtacacgttaccactg
ctatgcatggaaaaagacaaatttttattgtcagctatgatgtcttttcactacttctca
ttgcctttcaagaaagcctcccaagaaagtctcactattccactctgtacatactgcttc
actgttggagcttaa

DBGET integrated database retrieval system