KEGG   Monodelphis domestica (opossum): 100012187Help
Entry
100012187         CDS       T01031                                 

Gene name
UCHL3
Definition
ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase)
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
mdo  Monodelphis domestica (opossum)
Brite
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100012187 (UCHL3)
Peptidases [BR:mdo01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   100012187 (UCHL3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 332 aa AA seqDB search
MESHRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMEPELLSMVPRPVCAVLLLFPITE
KYEVFRIEEEEKIKSEGQDVTESVYFMKQTISNACGTIGLIHAIANNKDKMNFESGSTLK
KFLEDSLSMSPEERARYLEKYEAIRVTHESSAHEGQTEGAELGPKSGSYWEANFSSLENV
LQQLKPTESHMDCHVESSSPSSSQPHSSHCRTKASPLCHHASLPWVKRNHVGPAKATSPS
LRLRRWRPFLRLPSVGLHSVAPSIDEKVDLHFIALVHVDGHLYELDGRKPFPINHGKTSD
DTLLEDAIEVCKKFMERDPEELRFNAIALSAV
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggagagtcaccgctggctgcctctggaggccaatcccgaggtcaccaaccagtttctc
aaacaattaggtctgcaccccaactggcagtttgttgatgtatatggtatggaacctgaa
ctccttagcatggtgccacggccagtctgtgcggtattgcttctttttccaattacagaa
aagtatgaagtattcagaatagaagaggaagaaaaaataaaatcagaaggacaagacgtc
acagaatcagtatatttcatgaagcaaaccatcagtaatgcttgtggaacaattggactg
atccatgccattgctaacaacaaagacaaaatgaattttgaatctggatcaacattgaaa
aaattcttggaagattccctaagtatgagtcctgaagaaagagccagatacctagaaaaa
tatgaagctattcgagttactcatgaatcgagtgcccatgaaggtcagacagagggggca
gaactgggaccgaagagtggaagttactgggaggcaaatttcagctccttagaaaacgtt
cttcaacagttaaaaccaactgaaagtcatatggattgccatgttgagtcgtcctcgcca
tcctcatcacagcctcattctagccactgcagaacgaaggcctcaccattgtgtcaccat
gcatccctgccctgggtcaaacgtaaccatgtaggtcctgcaaaggctaccagtccatct
ctccgtcttcgtcgctggcggcccttcttacgcctgccgtctgtggggcttcattctgtt
gcaccaagtatagatgaaaaagtagatctacattttattgcattagttcatgtagatggg
catctctatgaattagatgggcgcaagccatttccaattaaccatggaaaaactagtgat
gatactttattagaggatgccatagaagtttgcaagaagttcatggaacgtgacccagaa
gaattaagatttaatgctattgctctttctgcagtgtag

DBGET integrated database retrieval system