KEGG   Monodelphis domestica (opossum): 100012195Help
Entry
100012195         CDS       T01031                                 

Gene name
DYRK1B
Definition
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1B
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
mdo  Monodelphis domestica (opossum)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 638 aa AA seqDB search
MAAPPSHGPFSGFPAPQEHTQVVPDVRLLQRRLPLAFRDATSAPLRKLSVDLIKTYKHIN
EVYYAKKKRRAQQGPPEDASTKKERKVLNHGYDDDNHDYIVRSGERWLERYEIDSLIGKG
SFGQVVKAYDHQAQELVAIKIIKNKKAFLNQAQIELRLLELMNQHDTEMKYYIVHLKRHF
MFRNHLCLVFELLSYNLYDLLRNTHFRGVSLNLTRKLAQQLCTALLFLATPELSIIHCDL
KPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGTPYDLAIDMWSLG
CILVEMHTGEPLFSGSNEVDQMNRIVEVLGLPPAPMLEQAPKARKYFDRLPGGGWTLRRS
KDLRKEYQGPGTRRLQEVLGVQTGGPGGRRAGEPGHSTADYLRFQDLVLRMLAYEPAARI
SPLGALQHGFFRRTADEATNTGPSGSSTSTSPSPAPDASHSSSAASSVSSSGGSSGSSND
NRSYRYSNRYCGGPGPPVTDCEMHSPQVPPSQPLRPWAGGDVAHKPPPGPAPAPASSSSS
FHGAQAGSSSSSSPPPPELMDVSLGGGPLLPQPAPQDCAPLRPAPPLQHPATSAFRTRTT
GGGGPRGGGRPPIPPPEDPALGPRLGLCGVPQSTAASS
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atggccgcccctcccagccatggtcctttctccggcttcccagccccccaggagcataca
caggtggttccagatgtcaggctgctacagcgacggctcccgctggcctttcgggatgcc
acctccgcccccctccgaaagctctctgtggacctcatcaagacctacaagcacattaat
gaggtgtactacgccaagaaaaagcgtcgggcccagcagggtcccccagaggacgcaagc
acaaagaaagagcggaaggttctgaaccacggctatgatgatgacaaccatgactacatt
gtgcgaagcggggaacggtggctggagcgctatgagatcgactcactcattgggaagggt
tcctttgggcaggtggtgaaggcctatgaccaccaggcccaggagctggtggccatcaag
atcattaagaacaagaaggcatttctgaaccaggcgcagattgagttgcggctgcttgag
ctgatgaaccagcatgacacagagatgaagtactacattgtgcatctgaaacgacatttc
atgttccggaaccacctgtgcctggtctttgagctcctctcctacaacctgtacgacctg
ctgaggaacacccactttcggggcgtctcactgaacctgacccggaagctggcacagcag
ctctgcacggctctgctcttcctggccacccctgagctcagcatcatccactgcgacctc
aagcccgagaacatcctcctctgtaaccccaaacgcagcgccatcaaaatcgtcgacttt
ggcagctcctgccagctgggccagcggatctatcagtatatccagagccgcttctaccgc
tcacctgaggtgctcctggggaccccgtatgacctggccattgacatgtggtctttaggc
tgtatccttgtggagatgcacacgggagagcccctcttcagtggttctaatgaggtggac
cagatgaataggattgtggaagtgctggggctacccccagctcccatgctggaacaggca
cccaaggctaggaagtactttgatcggttgcctggagggggctggaccctccggaggagc
aaagacctcaggaaggagtaccagggacctggcacgcggcggctgcaggaggtgctgggc
gtgcagacaggcggccctgggggccggcgggcaggcgagccaggccatagcacagccgac
tacctccgcttccaggacctggtgctgcgcatgctggcatatgagccggccgcccgcatc
agccccctgggggccctgcagcatggtttcttccgtcgaaccgctgacgaggcgaccaac
acggggccctcggggagcagcacctccacctccccctctccagcccccgacgcctcccac
tcctccagtgcagccagctctgtctccagctctggtgggtccagcggatcatcgaatgac
aaccggagctaccgctacagcaaccggtactgtgggggcccagggcctccggtgacggac
tgcgagatgcatagcccccaggtcccaccttcccagccgctgcgcccttgggcaggggga
gacgtggcccacaagcctcccccgggcccagccccggccccagcctcctcttcctcctcc
ttccacggggcccaggctggctcttcttcctcttcctcaccacctcctcctgagctgatg
gacgtgagccttggaggtggccccctgctgcctcagcctgccccacaggactgtgcccca
ctccgccccgctccccctctccagcacccggccacttcggccttccggactcggaccaca
ggggggggcggccccaggggcgggggccggccgccgatccccccacctgaggacccagcc
ctaggcccccgcctgggcctctgcggtgtcccccagagtacggccgccagctcgtga

DBGET integrated database retrieval system