KEGG   Monodelphis domestica (opossum): 100012326Help
Entry
100012326         CDS       T01031                                 

Gene name
EIF3J
Definition
eukaryotic translation initiation factor 3, subunit J
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
mdo  Monodelphis domestica (opossum)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100012326 (EIF3J)
Translation factors [BR:mdo03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    100012326 (EIF3J)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 371 aa AA seqDB search
MSVAPPPPWSRSLLPIRQSFRPPGPPEAPPPPPSSSVRLGPTPVPFASRRRRCSVRLVPA
ARRGRGLGRALGSGPDAPPPSRRAPRWPARSYSVTHHPPSRALLPPSLPLALTHTRPEMA
AAAGDSDSWDADTFSVEEPVRKAGGAAGGDRWEGEDEDDDVKENWDDDDEEKKEETEVKP
ETKVSEKKKIAEKIKEKERQQKKRQEEIKKRLEEPEESKELTPEEQLADKLRLKKLQEEA
DLELAKETFGVNNTVCGIDAMNPSSRDDFTEFGKLLKDKITQYEKSLYYASFLEALVRDV
CISLEIDDLKKITNSLTVLCSEKQKQEKQSKAKKKKKGVVPGGGLKATMKDDLADYGGYD
GGYVQDFEDFM
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtcgcccctcctcctccctggtcccgctcgctgttgcccatccgtcagtctttt
cgtccacctggcccacctgaagccccgcctcctccgccctcttcttcggtacgacttggt
cccacccctgtcccgtttgcgtcaaggaggaggcggtgctcagtccgcctagttcccgcg
gctcgtagggggcggggcctcgggcgggctcttgggtctgggcccgacgctccgccgccg
tcccggcgtgccccgcgttggccagcgagaagctattcggtgactcaccacccgccctct
cgcgctctccttcccccttccctccctctcgcactcacacacacccggcccgagatggcg
gcggcagcgggggactcggactcctgggacgcggacacgttctcggtggaggagccggtg
cggaaggcggggggcgcggccggcggggaccgctgggagggcgaggatgaggatgacgac
gtcaaggaaaactgggatgacgatgatgaagaaaaaaaagaggagacagaggtaaaacca
gaaacaaaagtttcagaaaaaaagaaaatagcagagaaaatcaaagagaaagaacggcaa
cagaagaagagacaagaagaaattaagaaaaggttggaagaacccgaagaatcgaaagag
cttacaccagaagaacaattagcagataaactacggctaaagaaattacaggaagaggca
gaccttgaattagcaaaagaaacctttggtgttaataacacagtctgtggtatagatgct
atgaacccctcttcaagagatgacttcacagagtttggcaagttactaaaagataaaatt
acacagtatgaaaaatctctatattatgccagtttcttggaagcattagttcgagatgtg
tgcatttcattggaaattgatgacttgaaaaagattaccaattcactgacagtgctatgc
agtgaaaagcagaaacaagaaaagcaaagcaaagccaaaaagaagaagaaaggtgtggtt
cctggagggggattaaaggctacaatgaaagatgatcttgcagactatggtggatatgat
ggaggatatgtgcaagactttgaagacttcatgtga

DBGET integrated database retrieval system