KEGG   Monodelphis domestica (opossum): 100012508Help
Entry
100012508         CDS       T01031                                 

Gene name
KAT2A
Definition
K(lysine) acetyltransferase 2A
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Notch signaling pathway
Thyroid hormone signaling pathway
HTLV-I infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    100012508 (KAT2A)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    100012508 (KAT2A)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100012508 (KAT2A)
  Infectious diseases
   05166 HTLV-I infection
    100012508 (KAT2A)
Enzymes [BR:mdo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100012508 (KAT2A)
Transcription machinery [BR:mdo03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     100012508 (KAT2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 803 aa AA seqDB search
MRPLGWVRLAALRCAAPRCAAGEAMAEPAQAQAQTPTQTQVQVQAQTPQPRSLQSPAPAP
APAPAPTPCPGSAAAPAGAPGSGTPGVGSGAPGAGGDPARPGLSQQQRASQRKAQVRALP
RAKKLEKLGVFSACKANDACKCNGWKNPKPPTAPRMDLQQPAANLSEACRSCEHPLADHV
SHLENVSEDEINRLLGMVVDVENLFMSVHKEEDTDTKQVYFYLFKLLRKCILQMTRPVVE
GSLGSPPFEKPNIEQGVLNFVQFKFSHLAPRERQTMFELSKMFLLCLNYWKLETPAQFRQ
RSQGEDVATYKVNYTRWLCYCHVPQSCDSLPRYETTHVFGRSLLRSIFTVTRRQLLEKFR
VEKDKLVPEKRTLILTHFPKFLSMLEEEIYGENSPIWESGFTMPAAEGPQLVPRPATVST
AAVPSAPLFTQSLGGSSSSSLGLDPGGTEPMPGEKRKLPENLTLEDAKRLRVMGDIPMEL
VNEVMLTITDPAAMLGPETSLLSANAARDETARLEERRGIIEFHVIGNSLAPKXNRRVLL
WLGTRHLEGFQEGKGYGTHLMNHLKEYHIKHNILYFLTYADEYAIGYFKKQGFSKDIKVP
KSRYLGYIKDYEGATLMECELNPRIPYTELSHIIKKQKEIIKKLIERKQAQIRKVYPGLS
CFKEGVRQIPVESVPGIRETGWKPLGKEKGKELKDPDQLYTTLKNLLAQIKTHPSAWPFM
EPVKKAEAPDYYEVIRFPIDLKTMTERLRSRYYVTRKLFVADLQRVIANCREYNPPDSEY
CRCASALEKFFYFKLKEGGLIDK
NT seq 2412 nt NT seq  +upstreamnt  +downstreamnt
atgcggcccttgggctgggtgcgcctcgcagcgctgcgctgcgccgcgccgcgctgcgca
gcgggggaggctatggcggagccggcgcaggcccaggcccagactccaacccaaacccag
gtccaggtccaggcccagaccccgcagccccggagcctgcagtctccggctccggccccg
gccccggccccagctcctaccccctgcccaggctcggccgcggccccagcgggggcacca
gggagcgggacgcccggggtggggagcggggcgcctggagccgggggtgatccggcgcgg
cccggcctgagccagcagcagcgcgccagccagaggaaggcgcaggtccgcgcgctgccc
cgggccaagaagctggagaagctcggggtcttctcggcctgcaaggctaatgatgcttgc
aagtgtaatggctggaagaaccccaaacctcccactgctccccgaatggacctgcaacaa
cctgcagctaacttaagtgaggcctgccggagctgcgagcatcccctggctgaccatgtg
tcccacctggagaacgtgtctgaggatgaaatcaacaggctgctggggatggtggtggat
gtagagaatctgttcatgtctgtacacaaggaagaagacacagacacgaaacaggtttac
ttctacctctttaagcttttgagaaaatgcatcctacagatgacacgaccagtagtagag
ggatcactgggaagtcccccctttgagaagcccaatattgagcagggtgtactgaatttt
gtgcagtttaagttcagccatctggccccgagggagcggcagacgatgtttgagctctcc
aagatgttcctgctctgtcttaactactggaagctggagactcctgctcagttccggcag
aggtcacagggtgaagatgtggccacctacaaggtcaattacaccaggtggctgtgttac
tgtcatgtcccacaaagctgtgacagcctgccccgatatgagacaacccatgtctttggg
cgaagtctccttcgatccatctttactgttacccgccgacagctgctagagaagtttcga
gtggagaaggacaaactggtacccgagaagaggacgcttatccttactcatttccccaag
ttcctgtccatgttagaggaagaaatctatggggaaaattcccctatctgggaatcaggt
ttcaccatgcctgctgcagaggggccacagttagttccccgtccagccactgtcagtact
gcagctgtgccaagtgccccgttattcacccagagcctgggtggcagtagcagcagctcc
cttggcctagaccctggagggacagagcccatgccaggtgaaaagaggaagctccctgag
aacctgaccttggaagatgcaaagcgacttcgagtaatgggggatatacccatggaattg
gtcaatgaggtcatgttgaccatcacagaccctgcagccatgcttgggcctgagaccagc
ttgctgtcagccaatgcggcccgggatgagactgctcggctagaggaacgtcgtgggatc
attgagttccatgtcataggaaattcgctggcaccaaagngcaatcgtcgtgtattgctc
tggctgggcaccaggcaccttgagggtttccaagaggggaaaggatacgggactcacctc
atgaaccacctgaaggagtatcacatcaaacacaatatcctctacttcctcacctatgcg
gatgagtacgccatcggctacttcaaaaagcagggtttctccaaggatatcaaggttccc
aagagccgctatctgggttacatcaaggattatgagggggccacgctgatggagtgtgag
ctgaatcccaggattccctatactgaactttcccatatcatcaagaagcagaaagagata
atcaagaaactgattgagcgcaaacaggctcagattcggaaggtgtacccggggcttagc
tgcttcaaggagggtgtaagacagatccctgtggagagtgtccccggcatccgcgagaca
ggatggaagccgctggggaaggagaaggggaaggagctcaaggaccctgaccagctctat
acaaccctcaaaaacctgttggctcagatcaagacccaccccagtgcctggcccttcatg
gagcctgtgaagaaggcagaagctccagattattatgaggtcatccgcttccccattgac
ctgaagaccatgacggagcgtctcaggagccgctactacgtgactaggaaactctttgtg
gctgacctgcagagagtgattgccaactgccgggagtacaaccccccagacagcgagtat
tgccgctgtgccagcgccctcgagaaattcttttatttcaagttaaaagaagggggcctt
attgacaagtag

DBGET integrated database retrieval system