KEGG   Monodelphis domestica (opossum): 100012509Help
Entry
100012509         CDS       T01031                                 

Gene name
CDKN2D
Definition
cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4)
Orthology
K06623  
cyclin-dependent kinase inhibitor 2D
Organism
mdo  Monodelphis domestica (opossum)
Pathway
FoxO signaling pathway
Cell cycle
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    100012509 (CDKN2D)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    100012509 (CDKN2D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 167 aa AA seqDB search
MLLEEISAGDRLSGAAARGDVNEVRRLLHQEFVHPDSLNRFGKTALQVMMFGSSPIALEL
LKQGASPNVQDGSGTSPAHDAARTGFLDTLRVLVEHGADVNVPDGSGALPIHLAVREGHA
AVVSFLAGESDLQHRDAGGLTPLELARQCGAGQLGRILERHLPTPSL
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgttgctagaagagataagcgccggggaccgactcagcggagctgccgcccgaggggat
gtgaacgaggtgcggcgcctccttcaccaggaattcgtacatcccgactccctgaaccgc
ttcggcaagaccgccctgcaggtcatgatgtttggaagctcgcccatcgctctggagcta
ctaaagcagggagccagccccaatgtccaggacgggtcgggcacttccccggcccacgac
gcagcgcgcacaggattcctagacactcttcgggtcctggtggagcacggcgcagacgta
aacgttcccgacggctccggggcactgcctatccacctggcggtccgagaaggtcacgca
gcggtggtcagtttcttggcaggggaatctgacctgcagcaccgggatgccgggggcctc
acacccctggaactggctcggcaatgtggtgccgggcagttggggcggatcttggagagg
cacctccctactccttcattgtga

DBGET integrated database retrieval system