KEGG   Monodelphis domestica (opossum): 100012535Help
Entry
100012535         CDS       T01031                                 

Gene name
PAICS
Definition
phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase
Orthology
K01587  
phosphoribosylaminoimidazole carboxylase / phosphoribosylaminoimidazole-succinocarboxamide synthase [EC:4.1.1.21 6.3.2.6]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Purine metabolism
Metabolic pathways
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:mdo00230]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 409 aa AA seqDB search
MATAEVMNIGKKLYEGKTKEVYELLDSPGKVLLQSKDQITAGNAARKNHLEGKAAISNKI
TSCIFELLQEAGIKTAFTKKCGETAFIAPQCEMIPIEWVCRRIATGSFLKRNPGVKEGYK
FYPPKVELFFKDDANNDPQWSEEQLIAAKWCFAGLSIGQTEVDIMSHSTQAIFEILEKSW
LPQNCTLVDMKIEFGVDVTTKEIVLADVIDNDSWRLWPSGDRAQQKDKQSYRDLFCMHSL
KLLQKVESSCRVVVLMGSTSDLGHCEKIKKACGNYGIPCELRVTSAHKGPDETLKIKAEY
EGDGVPTVFVAVAGRSNGLGPVMSGNTAYPVVNCPPLTPDWGAQDVWSSLRMPSGLGCST
ILSPEGAAQFAAQIFGLNNHLVWAKLRGSILNTWVSLKQADKKIRECSL
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atggctaccgcagaagtgatgaatattggtaagaaactctatgaaggtaaaacaaaagaa
gtctatgaattgttggatagtcctggaaaagtcctcttgcagtctaaagaccagattact
gcaggcaacgcagctagaaaaaatcacttggaaggaaaagctgcaatctcaaacaaaatt
accagctgtattttcgagttgttacaggaagcaggtatcaaaactgctttcaccaaaaaa
tgtggtgagacagcttttattgcacctcagtgtgaaatgattccaattgaatgggtatgt
agaagaattgcaactggttcttttcttaaaagaaatcctggtgtcaaagaaggatacaag
ttctacccacctaaagtagagttgtttttcaaggatgatgccaacaatgatccacagtgg
tctgaagaacagcttattgctgcaaaatggtgttttgctggacttagcataggtcagact
gaagtggatatcatgagtcattccacacaggctatttttgaaatactggaaaagtcctgg
ttgcctcagaactgtacattggttgacatgaagattgaatttggtgttgatgtaactaca
aaagaaattgtactcgctgatgttattgataatgattcctggagactctggccatctggt
gatcgagcccaacagaaagacaaacagtcataccgggacctcttttgtatgcactccctg
aagttacttcagaaagtagaaagttcatgcagagttgttgtattgatgggctctacttct
gaccttggtcattgtgaaaaaattaaaaaggcttgtggaaactatggaattccctgtgaa
ctccgagtaacatctgcccataaagggccagatgaaactctaaagattaaagcagaatat
gaaggcgatggtgttcctactgtatttgtggctgtagctggcaggagcaatggtttggga
cctgtgatgtctggtaacactgcatatccagtagtcaactgtcctccgcttacacctgat
tggggagctcaagatgtatggtcctcacttcgaatgcctagtggtcttggctgttcaact
atactttctcctgagggagcagctcagtttgcagcccagatatttggattaaataaccat
ttggtatgggctaaacttcgaggaagcatattaaacacctgggtttctttgaagcaagca
gataagaaaatcagagaatgcagtttataa

DBGET integrated database retrieval system