KEGG   Monodelphis domestica (opossum): 100012535Help
Entry
100012535         CDS       T01031                                 

Gene name
PAICS
Definition
uncharacterized LOC100012535
Orthology
K01587  
phosphoribosylaminoimidazole carboxylase / phosphoribosylaminoimidazole-succinocarboxamide synthase [EC:4.1.1.21 6.3.2.6]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Purine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    100012535 (PAICS)
Enzymes [BR:mdo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.21  phosphoribosylaminoimidazole carboxylase
     100012535 (PAICS)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.6  phosphoribosylaminoimidazolesuccinocarboxamide synthase
     100012535 (PAICS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 1011 aa AA seqDB search
MESGAGKHWTEEEVKALLSIWSEKNIRKQLYGTLRNKGIFIYIAKRLQEKGIFRGWKQCR
AKYKNLKYEYRTVKYAHNSGDVSKTMKFFHELDVILQYEPVSQLTEDEDSRYLATETQLD
INTAPGNTKGEIPVALEDDEDISRDPLLFISHIRPMELGKPTSILDSSNNPTFIPSVANE
GGKHWTINEVRALIGIWSEKNIQKQLEGTMRNKRIFEQIAARLQKFGIDRDWKQCRTKYK
NLKHEYKIVKNSQDLGTTKSMKFFAELDAILGHTTEQSQKLENEGRQRPIKQTDIKMEKD
NMVISEDVVEGSISNISEDLGETAVKENHHTVQDPDKEVVTVEDPRVLHIKRESLDMDED
SLSTASEDLGGPVETDEVNGPDNYIPLEDAHNHLKIITVSDAEAGKHWCDNEVRALIHIW
SDEKIRQMLEGATRNKEIFKEIARRLLQFGIDRDWKQCRTKYKNLKYEYRVLQKKTNNLG
SNPGRKMRFYEEIDCILRQQNLGKHSWKNSSSLISESGEGHVMTARSLNKRKAYENELVP
LPLKRSASDTTMHQFHQSITEQKNSTDNLCRQETKQVSLPQSANQVSSVLTLSAASRCTA
KEMATAEVMNIGKKLYEGKTKEVYELLDSPGKVLLQSKDQITAGNAARKNHLEGKAAISN
KITSCIFELLQEAGIKTAFTKKCGETAFIAPQCEMIPIEWVCRRIATGSFLKRNPGVKEG
YKFYPPKVELFFKDDANNDPQWSEEQLIAAKWCFAGLSIGQTEVDIMSHSTQAIFEILEK
SWLPQNCTLVDMKIEFGVDVTTKEIVLADVIDNDSWRLWPSGDRAQQKDKQSYRDLFLPE
RVELLQKVESSCRVVVLMGSTSDLGHCEKIKKACGNYGIPCELRVTSAHKGPDETLKIKA
EYEGDGVPTVFVAVAGRSNGLGPVMSGNTAYPVVNCPPLTPDWGAQDVWSSLRMPSGLGC
STILSPEGAAQFAAQIFGLNNHLVWAKLRGSILNTWVSLKQADKKIRECSL
NT seq 3036 nt NT seq  +upstreamnt  +downstreamnt
atggagagtggagctgggaagcattggactgaagaggaggttaaagctttgctaagtatc
tggtcagaaaaaaacataaggaaacaactttacggaacactaagaaataaaggaatattc
atctacattgccaaaaggcttcaggaaaaaggcattttcagaggctggaaacagtgtcgg
gcaaagtataaaaatctgaagtatgaatacaggacagtcaaatatgcccacaactctgga
gatgtctctaaaactatgaagttctttcatgagctggatgtgatattacaatatgaaccg
gtctcacaattaacagaagatgaagacagcaggtacctggcaactgagacccagctggac
ataaatacagctccagggaacaccaaaggtgaaataccagttgcactagaagatgatgag
gatatctcaagggatcctttactttttatttcccatatcagaccaatggaactaggtaaa
ccaacttcaatactggattcttcaaataatccaacatttattccaagtgtagcaaatgaa
ggaggaaaacactggactataaacgaagtcagggctctaataggcatttggtcagaaaaa
aacattcaaaaacaactagagggaaccatgagaaataaaagaatatttgaacaaattgct
gccagacttcaaaaatttggtatagacagagattggaagcagtgtagaacaaaatataaa
aacttgaaacatgaatacaagattgtaaaaaattctcaagacttgggaacaacaaaaagt
atgaaatttttcgctgagttggatgctattctgggacatactacagaacaatcacagaaa
ctagaaaacgaaggaagacaaagacctataaaacagacagatataaaaatggaaaaggac
aatatggtaatttctgaagatgtagttgaaggttcaattagcaacatatctgaagaccta
ggagaaacagctgtaaaagaaaatcatcatacagttcaagatccagataaagaagttgta
acagttgaagacccaagagttttacacataaaaagagaaagtttagacatggatgaggac
tccttaagtactgcttcagaagacctgggtggcccagtagaaacagatgaagtaaatggg
ccagataattacatccctttggaagatgctcataatcacttaaagatcatcacagttagt
gatgctgaggctggaaaacactggtgtgacaatgaagtcagagcactaatacacatatgg
tcagatgaaaaaatcaggcaaatgttggaaggggcaacaagaaacaaagaaatattcaag
gaaattgctagaagactactgcagtttggaatagatcgagactggaagcaatgccgtaca
aaatataaaaatttaaaatatgagtatcgagtgctacaaaagaaaactaataaccttggg
agtaaccctggaaggaaaatgaggttttatgaagaaattgattgcatcctaagacaacag
aatcttggaaaacacagctggaaaaatagctctagtcttatatcagaatcaggtgaaggt
catgtcatgactgcaagatctttgaacaagagaaaagcatatgaaaatgaactggtccct
ctccctctaaaaaggagtgcttctgacaccactatgcatcaattccaccagagtataaca
gaacaaaaaaattctacagataatctctgtagacaggaaacaaagcaagttagcctgcct
cagtctgccaaccaggtttcttcggtccttacgttatctgccgcttctcgctgcacagcc
aaggaaatggctaccgcagaagtgatgaatattggtaagaaactctatgaaggtaaaaca
aaagaagtctatgaattgttggatagtcctggaaaagtcctcttgcagtctaaagaccag
attactgcaggcaacgcagctagaaaaaatcacttggaaggaaaagctgcaatctcaaac
aaaattaccagctgtattttcgagttgttacaggaagcaggtatcaaaactgctttcacc
aaaaaatgtggtgagacagcttttattgcacctcagtgtgaaatgattccaattgaatgg
gtatgtagaagaattgcaactggttcttttcttaaaagaaatcctggtgtcaaagaagga
tacaagttctacccacctaaagtagagttgtttttcaaggatgatgccaacaatgatcca
cagtggtctgaagaacagcttattgctgcaaaatggtgttttgctggacttagcataggt
cagactgaagtggatatcatgagtcattccacacaggctatttttgaaatactggaaaag
tcctggttgcctcagaactgtacattggttgacatgaagattgaatttggtgttgatgta
actacaaaagaaattgtactcgctgatgttattgataatgattcctggagactctggcca
tctggtgatcgagcccaacagaaagacaaacagtcataccgggacctctttttgccagaa
agagtggagttacttcagaaagtagaaagttcatgcagagttgttgtattgatgggctct
acttctgaccttggtcattgtgaaaaaattaaaaaggcttgtggaaactatggaattccc
tgtgaactccgagtaacatctgcccataaagggccagatgaaactctaaagattaaagca
gaatatgaaggcgatggtgttcctactgtatttgtggctgtagctggcaggagcaatggt
ttgggacctgtgatgtctggtaacactgcatatccagtagtcaactgtcctccgcttaca
cctgattggggagctcaagatgtatggtcctcacttcgaatgcctagtggtcttggctgt
tcaactatactttctcctgagggagcagctcagtttgcagcccagatatttggattaaat
aaccatttggtatgggctaaacttcgaggaagcatattaaacacctgggtttctttgaag
caagcagataagaaaatcagagaatgcagtttataa

DBGET integrated database retrieval system