KEGG   Monodelphis domestica (opossum): 100012580Help
Entry
100012580         CDS       T01031                                 

Definition
glycogenin-1-like
Orthology
K00750  
glycogenin glucosyltransferase [EC:2.4.1.186]
Organism
mdo  Monodelphis domestica (opossum)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
7
AA seq 374 aa AA seqDB search
MTLKENSFMLVPGIFPAFWSSPEDQSFVTLSTNDSYAKGALVLGSSMKQHRTTKRLTVLI
TPQVSEPMRKVLEKIFDEVIMVDILDSKDSAHLTLMKRPELGVTLTKLHCWSLIQYQXXX
XCVFMDADTLVLTNIDELFEREELSAAPDPGWPDCFNSGVFVYRPSIETYNQLLHMASEQ
GSFDGGDQGLLNTFFSSWATTDIRKHLPFIYNLSSISIYSYLPAFKAFGANAKVVHFLGR
VKPWNYTYDPRTKSVRSDIHDPTVVNPQFLTMWWDIFSTSILPLLQQFGVVKDTFTTLNA
LSGLAYTLAFSCGFCRKEEVTDAISHMSIGNLSPPPQPFVSSDERKERWEQGQADYMGAD
SFDNIKRKLDTYLQ
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgactttaaaagaaaatagttttatgttggttccagggatcttccctgcattttggtcc
tccccggaagatcagtcctttgtgacattgtcaacaaatgattcctatgccaaaggagcc
ttggtgctcggctcctccatgaaacaacacagaacaacgaagaggttaactgtactgata
actccgcaagtctcagaacctatgaggaaagttttagagaagattttcgatgaagtcatc
atggtcgacatcttggacagcaaggattcggctcatctaaccttaatgaaaagacctgaa
ctgggtgtcacattaaccaaactccactgctggtcactaattcagtatcaaaannnnnnn
nnntgtgtgttcatggatgcagatactctggtactgacaaatattgatgagctttttgag
agagaagagctatcagcagcaccagacccagggtggccagactgtttcaattctggagtc
tttgtttatcgaccttccattgaaacatataatcagctgttgcatatggcttctgaacaa
ggcagctttgatggtggggaccagggtttgctgaacaccttctttagcagttgggcaaca
acagatatccgaaagcacctgccatttatttataacctaagcagcatttctatatattcc
tacctcccagcatttaaagcgtttggagcaaatgcaaaagtcgtgcattttctgggacga
gtcaaaccgtggaactatacctacgaccccagaacgaaaagcgtcaggagcgacattcat
gaccccactgtggtcaacccacagttcctcaccatgtggtgggacatcttcagcaccagc
attttgcctttactccagcagtttggagtcgttaaagacaccttcacaacccttaacgcg
ctttcgggtttggcctatactctggctttctcttgtggcttctgtagaaaggaggaagtc
acagatgcaatctcacatatgtccattgggaacctcagccctccacctcaaccgtttgtg
tcatcagatgaacgcaaagagcggtgggagcaaggccaggctgattacatgggagcagat
tcctttgacaatatcaagaggaaactggacacttatctccagtaa

DBGET integrated database retrieval system