KEGG   Monodelphis domestica (opossum): 100012580Help
Entry
100012580         CDS       T01031                                 

Gene name
GYG1
Definition
glycogenin 1
Orthology
K00750  
glycogenin glucosyltransferase [EC:2.4.1.186]
Organism
mdo  Monodelphis domestica (opossum)
Brite
Enzymes [BR:mdo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.186  glycogenin glucosyltransferase
     100012580 (GYG1)
Glycosyltransferases [BR:mdo01003]
 Polysaccharide
  Storage polysaccharide
   100012580 (GYG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
7
AA seq 353 aa AA seqDB search
MTDQSFVTLSTNDSYAKGALVLGSSMKQHRTTKRLTVLITPQVSEPMRKVLEKIFDEVIM
VDILDSKDSAHLTLMKRPELGVTLTKLHCWSLIQYQXXXXCVFMDADTLVLTNIDELFER
EELSAAPDPGWPDCFNSGVFVYRPSIETYNQLLHMASEQGSFDGGDQGLLNTFFSSWATT
DIRKHLPFIYNLSSISIYSYLPAFKAFGANAKVVHFLGRVKPWNYTYDPRTKSVRSDIHD
PTVVNPQFLTMWWDIFSTSILPLLQQFGVVKDTFTTLNALSGLAYTLAFSCGFCRKEEVT
DAISHMSIGNLSPPPQPFVSSDERKERWEQGQADYMGADSFDNIKRKLDTYLQ
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgacagatcagtcctttgtgacattgtcaacaaatgattcctatgccaaaggagccttg
gtgctcggctcctccatgaaacaacacagaacaacgaagaggttaactgtactgataact
ccgcaagtctcagaacctatgaggaaagttttagagaagattttcgatgaagtcatcatg
gtcgacatcttggacagcaaggattcggctcatctaaccttaatgaaaagacctgaactg
ggtgtcacattaaccaaactccactgctggtcactaattcagtatcaaaannnnnnnnnn
tgtgtgttcatggatgcagatactctggtactgacaaatattgatgagctttttgagaga
gaagagctatcagcagcaccagacccagggtggccagactgtttcaattctggagtcttt
gtttatcgaccttccattgaaacatataatcagctgttgcatatggcttctgaacaaggc
agctttgatggtggggaccagggtttgctgaacaccttctttagcagttgggcaacaaca
gatatccgaaagcacctgccatttatttataacctaagcagcatttctatatattcctac
ctcccagcatttaaagcgtttggagcaaatgcaaaagtcgtgcattttctgggacgagtc
aaaccgtggaactatacctacgaccccagaacgaaaagcgtcaggagcgacattcatgac
cccactgtggtcaacccacagttcctcaccatgtggtgggacatcttcagcaccagcatt
ttgcctttactccagcagtttggagtcgttaaagacaccttcacaacccttaacgcgctt
tcgggtttggcctatactctggctttctcttgtggcttctgtagaaaggaggaagtcaca
gatgcaatctcacatatgtccattgggaacctcagccctccacctcaaccgtttgtgtca
tcagatgaacgcaaagagcggtgggagcaaggccaggctgattacatgggagcagattcc
tttgacaatatcaagaggaaactggacacttatctccagtaa

DBGET integrated database retrieval system