KEGG   Monodelphis domestica (opossum): 100012689Help
Entry
100012689         CDS       T01031                                 

Gene name
ARHGAP5
Definition
Rho GTPase activating protein 5
Orthology
K13709  
Rho GTPase-activating protein 5
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Focal adhesion
Leukocyte transendothelial migration
Class
Cellular Processes; Cell communication; Focal adhesion [PATH:mdo04510]
Organismal Systems; Immune system; Leukocyte transendothelial migration [PATH:mdo04670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 1505 aa AA seqDB search
MMAKNKEPRPPSYAISVVGLSGTEKDKGNCGVGKSCLCNRFVRSKADEYYSEHTSVLSTI
DFGGRVVNNDHFLYWGDVTQSGEDGIECKIHVIEQTEFIDDQTFLPHRSTNLQPYIKRAA
ASKLQSAEKLMYICTDQLGLEQDFDQKQMPEGKLSVDGFLLCIDVSQGCNRKFDDQLKFV
NNLYIQLSKSKKPILIAATKCDECVDHYLREVQAFASNKKNLIVVETSARFNVNVETCFT
ALVQMLDRTRGKPKIIPYLDAYKTQRQLVVTATDKFEKLVQTVRDYHATWKTVSNKLKNH
PDYEEYINLEGTRKARNTFSKHIEQLKQEHIRKRREEYINTLPRAFNTLLPNLEEIEHLT
WSEALKLMETRTEFPLCFVVLEKTPWDETDHIDKVNDRRIPFDLLSTLEAEKVYQNHVQH
LISEKRRVEMKEKFKKTLEKIQFISPGQPWEEVMCFVMEDEAFKYITEADSKEVYSRHQR
EIVEKAKEEFQEMLFEHSELFYDLDLNATPSSDKMSEIHTVLSEEPRYKALQKLAPDRES
LLLKHIGFVYHPTKETCLSGQNCMDIKVEQLLANSLLQLDHSRLRLYHDSANIDKVNLFI
LGKDGLAQELANEIRTQSTDDEYALDGKIYELDLRPVDSKSPYLSSQLWNAAFKPHGCFC
VFNSIESLNFIGDFIGKIRTEASQIRRDKYMANLPFTLILANQRDSVSKNLPILRHQGQQ
LANKLQCPFVDVPTGTYPRKFNEAQIKQALRGVLESVKRNLDVVSPVPTNKDIAEADLRI
VMCAMCGDPFSVDLILSPFLDSHACSAAQAGQSNSLMLDKIIGEKRRRIQITILSYHSSI
GVRKDELVHGYILVYSAKRKASMGMLRAFLSEVQDTIPVQLVAVTDSQADFFENEAIKEL
MTEGEHIATEITAKFTALYSLSQYHRQTEVFTLFFSDVLEKKNMIENSYLSDNTREATHH
NEDVFLPSPRECSFSYTGYIDSEDDTEAPPPYSPIGDDVQLLPTPSDRSKYRLDLEGNEY
PIHSTPNCHDHERNHKVPPPIKPKPVVPKTNVKKLDPNLLKTIEAGIGKNPRKQTSRVPL
AHPEDMDSSDNYAEPIDTIFKHKGYPDEIYVVPDDSQNRIIKIRNSFVNNTQGDEENGFS
DRTSKSHGERRPSKYKYKSKTLFSKAKSYYRRTHSDASDDEAFTTSKAKRKGRHRGSEED
PLLSPVETWKGGIDNPAITSDQELDDKKMKKKTHKVKEDKKQKKKTKPFNPPTRRNWESN
YFGMPLQDLVSPEKPIPLFVEKCVEFIEDTGLCTEGLYRVSGNKTDQDNIQKQFDQDHNV
NLVSMDVTVNAVAGALKAFFADLPDPLIPYSLHPELLEASKILDKTERLNALKEILKKFH
PVNYDVFRYVITHLNRVSQQNKINLMTADNLSICFWPTLMRPDFENREFLSTTKIHQSVV
ETFIQQCQFFFYNGEIVETANSVVPQPPLSNTGHLVEPMVPLQLPPPLQPQLIQPQLQAD
PLGII
NT seq 4518 nt NT seq  +upstreamnt  +downstreamnt
atgatggcaaaaaacaaagaacctcgtcctccatcctatgctataagtgtagtaggatta
tctgggactgaaaaagacaaaggtaactgtggtgttggaaagtcatgtttgtgcaataga
tttgtgcgttccaaagcagatgaatattactctgagcatacctctgtgcttagtacaatt
gactttggaggaagagtagtcaacaatgatcattttttgtactggggtgacgtaacacaa
agtggtgaagatggaatagaatgcaaaatccatgtcattgaacagactgagttcattgat
gatcagactttcttgcctcatcggagtacgaatttgcaaccatatataaaacgtgcagct
gcatccaaattgcagtcagcagaaaaactgatgtacatttgcactgatcaattaggctta
gagcaagactttgatcagaaacaaatgcctgaagggaaactcagtgtagatggcttttta
ttatgcattgatgtaagtcagggatgcaataggaagtttgatgatcaacttaagtttgtg
aataacctatatatacagttgtcaaaatcaaaaaaacctatactaatagcagcaactaaa
tgtgatgaatgtgtagatcattatcttcgagaggttcaggcatttgcttcaaacaaaaag
aatctcatcgtggtagaaacctcagcacgatttaatgtcaatgttgagacatgtttcact
gcactggtacaaatgttggatagaacccgtggcaaacctaaaattattccctatctggat
gcttataaaacacagagacaacttgttgtcacagcaacagataaatttgaaaaacttgtg
caaactgtgagagattatcatgcaacttggaaaactgttagtaataaattaaaaaatcat
cctgattatgaagaatatataaacttggagggaacacgaaaggccagaaatacattttca
aaacacatagagcaactcaagcaagaacatataagaaaaagaagagaggaatacatcaat
acactacctagagcttttaacacacttctgccaaatcttgaagagattgaacatttgacc
tggtcagaagccctaaaattaatggagacacgaacagaattcccattgtgttttgtggtg
ctggagaaaacaccttgggatgaaactgaccacatagacaaagtgaatgatagacggatt
ccatttgatctccttagcactttggaagcggaaaaagtctaccagaatcacgtacagcac
ctaatttctgaaaagaggagggtggaaatgaaggaaaaattcaagaaaactctggaaaaa
attcagtttatttcacctggacaaccctgggaagaggttatgtgttttgtaatggaggat
gaagcctttaaatatatcactgaggctgatagcaaagaggtatatagtaggcatcagcga
gaaatagttgaaaaagccaaagaagaatttcaggaaatgctttttgaacattctgaactt
ttttatgatctggatcttaatgcaacacccagttcagataaaatgagtgaaattcacaca
gttttaagtgaagaacccagatataaagctttacagaaacttgcccctgatcgagagtcc
cttctacttaagcatatagggtttgtttatcatcccactaaagaaacctgtcttagtggt
cagaattgcatggacattaaagtagagcaactacttgctaatagtcttttacaactggat
catagtagattaagactgtaccatgatagtgccaacatagataaagttaatcttttcatt
ttgggaaaggatggtcttgcacaagaactagcaaatgagataaggacacagtctactgat
gatgagtatgccttagatggaaaaatatatgaactagatcttcgaccagttgattcaaaa
tcaccttatctttctagtcagttatggaatgctgcctttaagccacatggatgcttctgt
gtatttaactctattgaatcacttaattttattggggacttcattggaaaaataagaact
gaagcatcacagattaggagagataaatatatggccaatcttccatttacattaatatta
gctaatcagagggacagtgttagcaaaaatttacctattcttagacatcaagggcaacag
ttggcaaacaaactacaatgcccttttgtagatgtacccactggtacataccctcgtaaa
tttaatgaagctcaaataaaacaagctctaaggggagtattggaatcagttaaacgcaat
ctggatgttgtaagccctgttcccaccaacaaagatatagctgaagctgacctgagaatt
gtcatgtgtgccatgtgtggtgatccatttagtgtggatcttattctttcaccatttctt
gactctcatgcttgtagtgctgctcaagctgggcagagtaactctttaatgcttgataaa
atcattggtgaaaaaagaagacgaatacagattacgatactgtcttatcattcttcaatt
ggggtaaggaaagatgaactggtccatggatatatattagtttactctgccaaaaggaaa
gcatccatgggaatgctccgagcatttctttcagaagttcaggatactattccggtacag
ttggtggcagttactgacagccaggcagatttttttgagaatgaggctatcaaagagtta
atgactgaaggagaacacatagcaactgagatcactgctaaatttacagcactctattct
ttatctcaatatcatcggcaaactgaggtttttacattgttctttagtgatgttttagag
aaaaaaaatatgatagaaaattcttacttgtctgataataccagagaggcaacacatcat
aatgaggatgtttttcttccatctcccagagagtgttctttttcttatactggctatatt
gattcagaagatgatactgaagcaccaccaccatatagtccaattggggatgatgttcag
ttgcttccaacacctagtgaccgatccaagtatcgattagatttggaaggaaatgaatac
ccaattcatagtaccccaaattgtcatgatcatgaacgaaatcataaagtgcctcctcca
ataaaacccaagccagttgtacctaagacaaatgtaaagaaattggatccaaatctctta
aagacaattgaagctggaattggtaaaaatccaagaaaacaaacctctagagttccttta
gcacatcctgaagatatggattcctcagataactatgcagaacctatcgacaccattttt
aaacataaaggttatcctgatgagatctatgttgtcccagatgatagtcagaatcgtatt
attaaaattagaaactcatttgtaaataatacccagggagatgaagaaaatggattttct
gatagaacatcaaaaagtcatggggaacggaggccttcaaaatataaatacaagtcaaag
acgttattcagcaaagccaaatcttattataggagaacacattcagatgcaagtgatgat
gaggcctttaccacttctaaagcaaaaagaaaaggaaggcatcgtggaagtgaggaagat
ccacttctttctcctgtggaaacctggaaaggtggcattgacaaccctgctattacttca
gatcaggaattggatgataaaaaaatgaagaaaaaaacacacaaagtaaaggaagataaa
aagcagaaaaagaaaactaagcctttcaatccaccaacccgtaggaattgggaaagtaat
tactttgggatgcccctacaggatctggtttcacctgagaagcctataccactgttcgtt
gaaaaatgtgtggaatttattgaagatacaggactttgtactgaaggactctatcgtgtt
agtgggaacaaaactgatcaagacaacattcaaaagcagtttgatcaagatcataatgtt
aatctagtatcaatggatgtgacagtaaatgctgttgctggagctcttaaagctttcttt
gctgacttaccagatcctttaattccatattctcttcatccagagttattagaagcatca
aaaatcctggataagacagaacgacttaatgcattgaaagagattttgaagaaattccat
cctgttaactatgatgtattcagatatgtaataacacatctaaacagagttagtcagcaa
aataaaatcaacctcatgacagcagacaacctatccatctgtttctggccaactctaatg
agacctgattttgaaaatcgagagtttctgtccaccactaaaatccatcagtctgttgta
gaaactttcattcagcagtgtcagttcttcttttacaatggagaaattgtagaaactgct
aactctgtggtgccccagcccccactttcaaatactggacatttggttgagccaatggta
ccacttcagttaccaccaccattgcaacctcagctaatacaaccacagttacaagcagat
cctcttggtattatataa

DBGET integrated database retrieval system