KEGG   Monodelphis domestica (opossum): 100013088Help
Entry
100013088         CDS       T01031                                 

Gene name
PDGFRA
Definition
platelet-derived growth factor receptor, alpha polypeptide
Orthology
K04363  
platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Calcium signaling pathway
Cytokine-cytokine receptor interaction
Endocytosis
PI3K-Akt signaling pathway
Focal adhesion
Gap junction
Regulation of actin cytoskeleton
HTLV-I infection
Pathways in cancer
MicroRNAs in cancer
Glioma
Prostate cancer
Melanoma
Class
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:mdo04014]
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:mdo04015]
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:mdo04010]
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:mdo04020]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:mdo04151]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:mdo04060]
Cellular Processes; Transport and catabolism; Endocytosis [PATH:mdo04144]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:mdo04810]
Cellular Processes; Cell communication; Focal adhesion [PATH:mdo04510]
Cellular Processes; Cell communication; Gap junction [PATH:mdo04540]
Human Diseases; Cancers; Pathways in cancer [PATH:mdo05200]
Human Diseases; Cancers; MicroRNAs in cancer [PATH:mdo05206]
Human Diseases; Cancers; Glioma [PATH:mdo05214]
Human Diseases; Cancers; Melanoma [PATH:mdo05218]
Human Diseases; Cancers; Prostate cancer [PATH:mdo05215]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:mdo05166]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 1085 aa AA seqDB search
MGTSPWALLVLGCLLTGPWLAFCQLPLPTVFPNEDEKVVQLHSSFTLRCSGDSEVSWQYP
MQDEEDHKIEVRNEENNSGLFVTVLEVVNASAVHTGLYTCYYNHTQTEETEIEGRDIYIY
VPDPDVAFVPSVMVDHLIFAEEHDSVTIPCRTTDPLAQVTLLNSDNKVVHAFYDSRQGFI
GNFAMGQFKCETTIKGKTFQTVPFNIYTITATPELEVEIEAEKTVYKTGETLVVTCAVLH
NEVVDLQWNYPGKVKNKGILKVDEIKVPSLKLVYTLTVPKVTVKDSGDYECAARHATKET
KKIKKVTISVHEKGFIELNPNFRQSEAINLHEVRHFVVDVQAYPPPKISWLKDNMTVIEN
LTEIITGLDKIQEIRYQSKLKLIRAKEEDSGNYTIMAQNEDDIKNYTFQLIIQVPASILD
LEDDNHGSAGGQTVKCMAEGTPLPVVEWMVCKDITKCNNETSWTHLASNTSDITEKQDSS
MVESQVTFNKIEDTMAVRCLARNLLGSVTRELKLVAPAMRSELTVAASVLVLLVIVIFSL
IILIVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILGSG
AFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNLLG
ACTKSGPIYIITEYCFYGDLVNYLHKNRDNFLSHHPEKTKKELDIFGMNSADESTRSYVI
LSFENNGDYMDMKQADTTQYVPMLERKQGSKYSDIQRSMYDRPASYKKKSVSDPEVKNLL
SDDSSEGLSLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLARD
IMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMMVD
STFYNKIKSGYRMAKPDHATSEVYEIMVKCWNSEPEKRPSFYHLSEIVENLLPGQYKKSY
EKIHLDFLKSDHPAVARMRVDCDNTYIGVTYKNEDQMKDWEGSYDEQRLSADSGYIIPLP
DIDPIPEDDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDPSDLI
EDSFL
NT seq 3258 nt NT seq  +upstreamnt  +downstreamnt
atgggtacctccccatgggcattgctggtcctgggatgtcttcttacagggccgtggctc
gcattttgccagcttccattacccactgtctttccgaatgaggatgaaaaggttgtgcag
ctgcattcatcttttaccctaagatgctctggggacagtgaagtgagctggcagtacccc
atgcaggatgaagaggaccacaaaatagaagtcagaaatgaggagaacaacagtggcctt
tttgtgacggtcctggaagtggtcaatgcctcagctgtccacacagggctgtacacttgt
tattacaaccatactcagacagaggagacggagatcgaaggcagagatatctacatctat
gtgccagatccagatgtagcgtttgtaccttctgtcatggttgatcatttaatttttgcg
gaggaacatgattctgtcactattccatgtcgcacaacggatcctctggctcaggtgacc
cttctcaacagtgataacaaagtggtacatgcattctatgatagcagacaaggctttatt
ggaaactttgccatgggacaattcaagtgtgagacaaccatcaaggggaaaacattccaa
acagttccattcaacatttatacaataacagctactccagagcttgaagttgagatagag
gcagagaaaactgtttacaaaacaggagaaactcttgttgtaacttgtgctgtcttgcac
aatgaggtggttgatcttcagtggaattacccgggaaaagtgaaaaacaaaggcattttg
aaagttgatgaaatcaaagttccatccctcaagttggtgtacacgctgactgtcccaaag
gtgacggtgaaagacagtggtgactatgaatgtgctgcccgtcatgctactaaggaaaca
aagaagattaagaaagtcaccatttctgtccatgagaagggatttattgagctcaatccc
aacttccgccagtcagaagccattaacttgcacgaagtgcgccattttgtagtggatgta
caggcgtatccaccaccaaagatatcttggcttaaggacaatatgactgtgattgagaat
ctcactgagatcatcactggcttagataagatccaggaaataaggtatcaaagcaagtta
aaactgattcgtgctaaggaagaagacagtggcaattacactattatggcccaaaatgag
gatgatattaagaactatacttttcaacttataattcaagttccagcttctattctggac
ctagaagatgacaaccatggctctgcaggagggcagacggtcaaatgcatggcagaaggg
acaccgcttccagttgtggaatggatggtttgcaaggacattacaaagtgtaataatgaa
acttcgtggacacatttggccagcaatacatccgacattacagaaaaacaagacagcagt
atggtagagagccaagtgaccttcaacaaaattgaagacactatggctgtacgatgccta
gcaaggaacttacttgggtcggtgactcgggaactgaaacttgtggctcctgctatgcgc
tcagaattgacagtggctgcctcagtcctagtgctgctagtgattgtcatcttttccctc
attatcctgatcgtcatatggaagcagaaacccaggtatgaaatccggtggagggtcata
gagtccatcagccctgatggccatgagtacatttatgtggacccaatgcagttgccttat
gattcaagatgggagtttcctagagatgggttagtccttggccgaatcctgggctcaggt
gcatttggaaaagtggtggaaggaactgcttatggattaagccgttcccaacctgtgatg
aaggtggcggtgaaaatgctaaaacccacagctagatctagtgaaaaacaggctctcatg
tcagaactgaagattatgactcatctgggaccccatttgaatatcgtaaatcttttagga
gcctgtaccaagtcagggcccatttatatcatcactgaatactgcttctatggggattta
gtcaactacctgcataagaacagagacaacttcttgagccatcatccagagaagacaaag
aaagagctggacatctttgggatgaactccgctgatgaaagcactaggagctatgtcatt
ttatcctttgaaaacaatggggattatatggacatgaagcaagcggataccacacaatac
gttcccatgctggagagaaaacagggctctaaatattcagatatccaaagatcgatgtat
gatcggcctgcatcatacaagaagaaatctgtatcagacccagaagttaaaaacctcctt
tcagatgatagttcagaaggtctcagtctcttggatctgctaagcttcacctatcaagta
gcccgaggaatggagtttttggcctctaaaaactgtgtgcaccgtgatctggctgctcgt
aatgtccttctggctcaaggaaaaatcgtgaagatttgtgactttggcctggccagagac
atcatgcatgattccaactatgtgtccaagggcagtacttttctccctgtgaagtggatg
gctcctgaaagtatctttgacaatctgtataccacactgagtgacgtctggtcttatggc
atcctgctatgggagatcttttcccttggaggcacaccctatcctggaatgatggtggat
tctactttctataataaaatcaaaagtggataccggatggccaaacccgaccatgccacc
agtgaagtatatgaaatcatggtgaagtgctggaatagtgagcccgagaagagaccctcc
ttttaccacctgagtgagattgtggaaaatttgctacctggacaatataagaagagttat
gagaaaatccacctggacttcctgaagagtgaccaccctgccgttgctcgcatgagagtg
gattgtgataacacttacattggtgtcacctacaaaaatgaagaccagatgaaggactgg
gagggcagctatgatgaacagaggctgagtgctgacagtggctatatcatccctctgcct
gacattgaccctatccctgaagatgacctaggcaagagaaacagacacagttcccagaca
tctgaggaaagtgccattgagacaggttccagcagctccaccttcatcaagagagaggat
gaaaccatcgaggatatcgacatgatggatgacattgggatagacccgtcagacctgatt
gaagacagcttcctgtaa

DBGET integrated database retrieval system