KEGG   Monodelphis domestica (opossum): 100013088Help
Entry
100013088         CDS       T01031                                 

Gene name
PDGFRA
Definition
platelet-derived growth factor receptor, alpha polypeptide
Orthology
K04363  
platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Calcium signaling pathway
Cytokine-cytokine receptor interaction
Endocytosis
PI3K-Akt signaling pathway
Focal adhesion
Gap junction
Regulation of actin cytoskeleton
HTLV-I infection
Pathways in cancer
MicroRNAs in cancer
Glioma
Prostate cancer
Melanoma
Central carbon metabolism in cancer
Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100013088 (PDGFRA)
   04015 Rap1 signaling pathway
    100013088 (PDGFRA)
   04010 MAPK signaling pathway
    100013088 (PDGFRA)
   04020 Calcium signaling pathway
    100013088 (PDGFRA)
   04151 PI3K-Akt signaling pathway
    100013088 (PDGFRA)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100013088 (PDGFRA)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100013088 (PDGFRA)
  Cell motility
   04810 Regulation of actin cytoskeleton
    100013088 (PDGFRA)
  Cellular commiunity
   04510 Focal adhesion
    100013088 (PDGFRA)
   04540 Gap junction
    100013088 (PDGFRA)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100013088 (PDGFRA)
   05230 Central carbon metabolism in cancer
    100013088 (PDGFRA)
   05231 Choline metabolism in cancer
    100013088 (PDGFRA)
   05206 MicroRNAs in cancer
    100013088 (PDGFRA)
   05214 Glioma
    100013088 (PDGFRA)
   05218 Melanoma
    100013088 (PDGFRA)
   05215 Prostate cancer
    100013088 (PDGFRA)
  Infectious diseases
   05166 HTLV-I infection
    100013088 (PDGFRA)
Enzymes [BR:mdo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100013088 (PDGFRA)
Protein kinases [BR:mdo01001]
 Tyrosine protein kinases
  PDGFR family [OT]
   100013088 (PDGFRA)
Enzyme-linked receptors [BR:mdo01020]
 Receptor tyrosine kinases
  RTK class III (PDGF receptor family)
   100013088 (PDGFRA)
Cytokine receptors [BR:mdo04050]
 Receptor tyrosine kinase
  RTK class III (PDGF receptor family)
   100013088 (PDGFRA)
Cellular antigens [BR:mdo04090]
 Proteins
  100013088 (PDGFRA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
5
AA seq 1085 aa AA seqDB search
MGTSPWALLVLGCLLTGPWLAFCQLPLPTVFPNEDEKVVQLHSSFTLRCSGDSEVSWQYP
MQDEEDHKIEVRNEENNSGLFVTVLEVVNASAVHTGLYTCYYNHTQTEETEIEGRDIYIY
VPDPDVAFVPSVMVDHLIFAEEHDSVTIPCRTTDPLAQVTLLNSDNKVVHAFYDSRQGFI
GNFAMGQFKCETTIKGKTFQTVPFNIYTITATPELEVEIEAEKTVYKTGETLVVTCAVLH
NEVVDLQWNYPGKVKNKGILKVDEIKVPSLKLVYTLTVPKVTVKDSGDYECAARHATKET
KKIKKVTISVHEKGFIELNPNFRQSEAINLHEVRHFVVDVQAYPPPKISWLKDNMTVIEN
LTEIITGLDKIQEIRYQSKLKLIRAKEEDSGNYTIMAQNEDDIKNYTFQLIIQVPASILD
LEDDNHGSAGGQTVKCMAEGTPLPVVEWMVCKDITKCNNETSWTHLASNTSDITEKQDSS
MVESQVTFNKIEDTMAVRCLARNLLGSVTRELKLVAPAMRSELTVAASVLVLLVIVIFSL
IILIVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILGSG
AFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNLLG
ACTKSGPIYIITEYCFYGDLVNYLHKNRDNFLSHHPEKTKKELDIFGMNSADESTRSYVI
LSFENNGDYMDMKQADTTQYVPMLERKQGSKYSDIQRSMYDRPASYKKKSVSDPEVKNLL
SDDSSEGLSLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLARD
IMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMMVD
STFYNKIKSGYRMAKPDHATSEVYEIMVKCWNSEPEKRPSFYHLSEIVENLLPGQYKKSY
EKIHLDFLKSDHPAVARMRVDCDNTYIGVTYKNEDQMKDWEGSYDEQRLSADSGYIIPLP
DIDPIPEDDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDPSDLI
EDSFL
NT seq 3258 nt NT seq  +upstreamnt  +downstreamnt
atgggtacctccccatgggcattgctggtcctgggatgtcttcttacagggccgtggctc
gcattttgccagcttccattacccactgtctttccgaatgaggatgaaaaggttgtgcag
ctgcattcatcttttaccctaagatgctctggggacagtgaagtgagctggcagtacccc
atgcaggatgaagaggaccacaaaatagaagtcagaaatgaggagaacaacagtggcctt
tttgtgacggtcctggaagtggtcaatgcctcagctgtccacacagggctgtacacttgt
tattacaaccatactcagacagaggagacggagatcgaaggcagagatatctacatctat
gtgccagatccagatgtagcgtttgtaccttctgtcatggttgatcatttaatttttgcg
gaggaacatgattctgtcactattccatgtcgcacaacggatcctctggctcaggtgacc
cttctcaacagtgataacaaagtggtacatgcattctatgatagcagacaaggctttatt
ggaaactttgccatgggacaattcaagtgtgagacaaccatcaaggggaaaacattccaa
acagttccattcaacatttatacaataacagctactccagagcttgaagttgagatagag
gcagagaaaactgtttacaaaacaggagaaactcttgttgtaacttgtgctgtcttgcac
aatgaggtggttgatcttcagtggaattacccgggaaaagtgaaaaacaaaggcattttg
aaagttgatgaaatcaaagttccatccctcaagttggtgtacacgctgactgtcccaaag
gtgacggtgaaagacagtggtgactatgaatgtgctgcccgtcatgctactaaggaaaca
aagaagattaagaaagtcaccatttctgtccatgagaagggatttattgagctcaatccc
aacttccgccagtcagaagccattaacttgcacgaagtgcgccattttgtagtggatgta
caggcgtatccaccaccaaagatatcttggcttaaggacaatatgactgtgattgagaat
ctcactgagatcatcactggcttagataagatccaggaaataaggtatcaaagcaagtta
aaactgattcgtgctaaggaagaagacagtggcaattacactattatggcccaaaatgag
gatgatattaagaactatacttttcaacttataattcaagttccagcttctattctggac
ctagaagatgacaaccatggctctgcaggagggcagacggtcaaatgcatggcagaaggg
acaccgcttccagttgtggaatggatggtttgcaaggacattacaaagtgtaataatgaa
acttcgtggacacatttggccagcaatacatccgacattacagaaaaacaagacagcagt
atggtagagagccaagtgaccttcaacaaaattgaagacactatggctgtacgatgccta
gcaaggaacttacttgggtcggtgactcgggaactgaaacttgtggctcctgctatgcgc
tcagaattgacagtggctgcctcagtcctagtgctgctagtgattgtcatcttttccctc
attatcctgatcgtcatatggaagcagaaacccaggtatgaaatccggtggagggtcata
gagtccatcagccctgatggccatgagtacatttatgtggacccaatgcagttgccttat
gattcaagatgggagtttcctagagatgggttagtccttggccgaatcctgggctcaggt
gcatttggaaaagtggtggaaggaactgcttatggattaagccgttcccaacctgtgatg
aaggtggcggtgaaaatgctaaaacccacagctagatctagtgaaaaacaggctctcatg
tcagaactgaagattatgactcatctgggaccccatttgaatatcgtaaatcttttagga
gcctgtaccaagtcagggcccatttatatcatcactgaatactgcttctatggggattta
gtcaactacctgcataagaacagagacaacttcttgagccatcatccagagaagacaaag
aaagagctggacatctttgggatgaactccgctgatgaaagcactaggagctatgtcatt
ttatcctttgaaaacaatggggattatatggacatgaagcaagcggataccacacaatac
gttcccatgctggagagaaaacagggctctaaatattcagatatccaaagatcgatgtat
gatcggcctgcatcatacaagaagaaatctgtatcagacccagaagttaaaaacctcctt
tcagatgatagttcagaaggtctcagtctcttggatctgctaagcttcacctatcaagta
gcccgaggaatggagtttttggcctctaaaaactgtgtgcaccgtgatctggctgctcgt
aatgtccttctggctcaaggaaaaatcgtgaagatttgtgactttggcctggccagagac
atcatgcatgattccaactatgtgtccaagggcagtacttttctccctgtgaagtggatg
gctcctgaaagtatctttgacaatctgtataccacactgagtgacgtctggtcttatggc
atcctgctatgggagatcttttcccttggaggcacaccctatcctggaatgatggtggat
tctactttctataataaaatcaaaagtggataccggatggccaaacccgaccatgccacc
agtgaagtatatgaaatcatggtgaagtgctggaatagtgagcccgagaagagaccctcc
ttttaccacctgagtgagattgtggaaaatttgctacctggacaatataagaagagttat
gagaaaatccacctggacttcctgaagagtgaccaccctgccgttgctcgcatgagagtg
gattgtgataacacttacattggtgtcacctacaaaaatgaagaccagatgaaggactgg
gagggcagctatgatgaacagaggctgagtgctgacagtggctatatcatccctctgcct
gacattgaccctatccctgaagatgacctaggcaagagaaacagacacagttcccagaca
tctgaggaaagtgccattgagacaggttccagcagctccaccttcatcaagagagaggat
gaaaccatcgaggatatcgacatgatggatgacattgggatagacccgtcagacctgatt
gaagacagcttcctgtaa

DBGET integrated database retrieval system