KEGG   Monodelphis domestica (opossum): 100013112Help
Entry
100013112         CDS       T01031                                 

Definition
muscarinic acetylcholine receptor M1-like
Orthology
K04129  
muscarinic acetylcholine receptor M1
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
PI3K-Akt signaling pathway
Cholinergic synapse
Regulation of actin cytoskeleton
Class
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:mdo04020]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:mdo04151]
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:mdo04080]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:mdo04810]
Organismal Systems; Nervous system; Cholinergic synapse [PATH:mdo04725]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
5
AA seq 463 aa AA seqDB search
MNVSAAPAVSPNITVLEPVKGPWQVAFIILTTGLLSLATVTGNLLVLVSFKVNSELKTVN
NYFLLSLACADLIIGVVSMNLYTTYLVMGHWALGSLACDLWLALDYVASNASVMNLLLIS
FDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTVKAGQCYI
QFLSEPIITFGTAMAAFYLPVTVMCVLYWRIYRETENRARELAALQGSETPGKGLGGGSS
SSSERSQPGPEGSPDAPARRCCCCWGPRLLPSYSWKEEEEEEEDEGYLESLTSSEGEEAG
FEVVIKMPMVGPEAPPPAKPPPRASPQTVKRPTKKARERPGKEPKRKGKEQLSKRKTFSL
VKEKKAARTLSAILLAFILTWTPYNIMVLVSTFCSHCVPETLWELGYWLCYVNSTINPMC
YALCNKAFRDTFRLLLLCRWDKRRWRKIPKRPGSVHRTPSRQC
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtgtccgcggccccagcggtgagccccaacatcacggtcctggagccggtgaag
ggcccctggcaggtggccttcatcatcctcaccacaggcctgctctcgctggccaccgtg
acgggcaacctgctggtgctggtgtccttcaaggtcaacagcgagctcaagacggtcaac
aactacttcctgctgagcctggcgtgcgccgacctcatcatcggggtcgtctccatgaac
ctgtacaccacgtacctggtcatgggccactgggccctgggctcgctggcctgcgacctg
tggctggccctggactatgtggccagcaacgcctccgtcatgaacctgctcctcatcagc
ttcgaccgctacttctcggtgacgaggcccctgagctaccgggccaagcgcacccctcgg
cgcgccgcgctcatgatcggcctggcctggctcgtgtccttcgtgctctgggccccggcc
atcctcttctggcagtacctggtgggcgagcggaccgtgaaggccggccagtgctacatc
cagttcctgtcggagcccatcatcaccttcggcacggccatggccgccttctacctcccc
gtcaccgtcatgtgcgtgctctactggcgcatctaccgagagactgagaaccgtgcccgg
gagctggccgctctgcagggctccgagacgccggggaagggcctcggcggaggcagcagc
agcagctcggagcgctcccagccgggccccgaaggctcccccgacgccccggccaggcgc
tgctgctgctgctgggggccgcggctcctcccttcctacagctggaaggaggaggaggaa
gaggaggaggacgaaggctacctggagtccctgacgtcctccgagggagaggaggcgggc
ttcgaggtggtcatcaagatgcccatggtggggcccgaggcgccccctccggccaagccg
ccgccccgggcctccccgcagacggtcaagcggcccaccaagaaggcccgcgagcggccg
ggcaaggagcccaagcggaaagggaaggagcagctgagcaagcgcaagaccttctcgctg
gtcaaggagaagaaggctgcgaggaccctgagcgccatcctgctggccttcatcctcacc
tggacgccctacaacatcatggtgctcgtgtccaccttctgcagccactgcgtgcccgag
accctgtgggagctgggctactggctctgctacgtcaacagcaccatcaaccccatgtgc
tacgcgctctgtaacaaggccttccgcgacaccttccgcctgctgctgctctgccgctgg
gacaagcggcgctggcggaagatccccaagcgcccgggctctgtccaccgcaccccatcc
cggcagtgctga

DBGET integrated database retrieval system