KEGG   Monodelphis domestica (opossum): 100013112Help
Entry
100013112         CDS       T01031                                 

Gene name
CHRM1
Definition
cholinergic receptor, muscarinic 1
Orthology
K04129  
muscarinic acetylcholine receptor M1
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Calcium signaling pathway
cAMP signaling pathway
Neuroactive ligand-receptor interaction
PI3K-Akt signaling pathway
Cholinergic synapse
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    100013112 (CHRM1)
   04024 cAMP signaling pathway
    100013112 (CHRM1)
   04151 PI3K-Akt signaling pathway
    100013112 (CHRM1)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100013112 (CHRM1)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100013112 (CHRM1)
 Organismal Systems
  Nervous system
   04725 Cholinergic synapse
    100013112 (CHRM1)
G protein-coupled receptors [BR:mdo04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Acetylcholine (muscarinic) [OT]
    100013112 (CHRM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 463 aa AA seqDB search
MNVSAAPAVSPNITVLEPVKGPWQVAFIILTTGLLSLATVTGNLLVLVSFKVNSELKTVN
NYFLLSLACADLIIGVVSMNLYTTYLVMGHWALGSLACDLWLALDYVASNASVMNLLLIS
FDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTVKAGQCYI
QFLSEPIITFGTAMAAFYLPVTVMCVLYWRIYRETENRARELAALQGSETPGKGLGGGSS
SSSERSQPGPEGSPDAPARRCCCCWGPRLLPSYSWKEEEEEEEDEGYLESLTSSEGEEAG
FEVVIKMPMVGPEAPPPAKPPPRASPQTVKRPTKKARERPGKEPKRKGKEQLSKRKTFSL
VKEKKAARTLSAILLAFILTWTPYNIMVLVSTFCSHCVPETLWELGYWLCYVNSTINPMC
YALCNKAFRDTFRLLLLCRWDKRRWRKIPKRPGSVHRTPSRQC
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtgtccgcggccccagcggtgagccccaacatcacggtcctggagccggtgaag
ggcccctggcaggtggccttcatcatcctcaccacaggcctgctctcgctggccaccgtg
acgggcaacctgctggtgctggtgtccttcaaggtcaacagcgagctcaagacggtcaac
aactacttcctgctgagcctggcgtgcgccgacctcatcatcggggtcgtctccatgaac
ctgtacaccacgtacctggtcatgggccactgggccctgggctcgctggcctgcgacctg
tggctggccctggactatgtggccagcaacgcctccgtcatgaacctgctcctcatcagc
ttcgaccgctacttctcggtgacgaggcccctgagctaccgggccaagcgcacccctcgg
cgcgccgcgctcatgatcggcctggcctggctcgtgtccttcgtgctctgggccccggcc
atcctcttctggcagtacctggtgggcgagcggaccgtgaaggccggccagtgctacatc
cagttcctgtcggagcccatcatcaccttcggcacggccatggccgccttctacctcccc
gtcaccgtcatgtgcgtgctctactggcgcatctaccgagagactgagaaccgtgcccgg
gagctggccgctctgcagggctccgagacgccggggaagggcctcggcggaggcagcagc
agcagctcggagcgctcccagccgggccccgaaggctcccccgacgccccggccaggcgc
tgctgctgctgctgggggccgcggctcctcccttcctacagctggaaggaggaggaggaa
gaggaggaggacgaaggctacctggagtccctgacgtcctccgagggagaggaggcgggc
ttcgaggtggtcatcaagatgcccatggtggggcccgaggcgccccctccggccaagccg
ccgccccgggcctccccgcagacggtcaagcggcccaccaagaaggcccgcgagcggccg
ggcaaggagcccaagcggaaagggaaggagcagctgagcaagcgcaagaccttctcgctg
gtcaaggagaagaaggctgcgaggaccctgagcgccatcctgctggccttcatcctcacc
tggacgccctacaacatcatggtgctcgtgtccaccttctgcagccactgcgtgcccgag
accctgtgggagctgggctactggctctgctacgtcaacagcaccatcaaccccatgtgc
tacgcgctctgtaacaaggccttccgcgacaccttccgcctgctgctgctctgccgctgg
gacaagcggcgctggcggaagatccccaagcgcccgggctctgtccaccgcaccccatcc
cggcagtgctga

DBGET integrated database retrieval system