KEGG   Monodelphis domestica (opossum): 100013114Help
Entry
100013114         CDS       T01031                                 

Definition
cytochrome P450 3A24-like
Orthology
K07424  
cytochrome P450, family 3, subfamily A [EC:1.14.14.1]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Steroid hormone biosynthesis
Linoleic acid metabolism
Retinol metabolism
Metabolic pathways
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100013114
   00591 Linoleic acid metabolism
    100013114
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100013114
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100013114
Enzymes [BR:mdo01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100013114
Cytochrome P450 [BR:mdo00199]
 Cytochrome P450, animal type
  CYP3 family
   100013114
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
6
AA seq 509 aa AA seqDB search
MTSYSGLSTETWTLLVAFVTLLILYGIWPYGIFKKLGIPGPRPLPFFGTFLEYRKGILEF
DKQCFQKYGKMWGFYDGRLPILAILDPDIIKIVLVKEFYTLFTNRRNFGLNGILDSGITV
AEGEKWKRIRSIISPTFTTGKLKEMFPIIKHHIDVLVNNIEKKVAQDESVNMKDIFGAYS
LDVITSTSFGVDIDSINKPNDPLLVHIKKLLSFSFMSPLLILILVFPSLVPILEKMNLSL
LSKENIDFLVNASRRIIADRKKSNSRDRVDFLQLMIDSQVMNGSRSEKRNNSPKALTEME
IVAQAVTFIFAGYETTSTTLNFITYNLATHPEIQKKLLEEIDSTLPNKAVPTYDTIFQME
YLDMVVNETLRLFPLGGRIERICQKTAEINGITIPKGTVMLIPVYVLHHDPEYWPEPEEF
RPERFDQEGRKSIDPYVFLPFGAGPRNCVGMRFALLTLKTALVTLLQNFTMEPCKETPIP
LELETKGFMQPKKPIILKLVPRPRPDVED
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgacttcctattctggcttatccacggaaacctggactttgctagtggcttttgtcact
ctgctgatattatatggaatctggccatatgggatttttaagaaattgggtattcctgga
ccaaggcctcttccattctttgggacattcctagaatatcgcaagggaattttggagttt
gacaagcaatgttttcagaaatatggcaaaatgtgggggttttatgatggcagacttcct
atattagccattctggatccagacatcatcaaaatagttctagtgaaagagttttacaca
ctcttcaccaatcgtcggaattttggtttaaatggaattttggattctggcatcactgtt
gctgaaggggagaagtggaaaaggatccggtccatcatttccccaacattcaccactggg
aaactcaaggagatgtttcccattatcaaacaccacatagatgttctggtgaacaacatt
gagaagaaagtggcccaggatgagtctgtgaatatgaaggacatctttggagcctacagt
ctggatgtcatcactagcacttcctttggtgtggacatcgactctatcaacaaacccaat
gacccccttcttgtccacatcaagaagctgctctctttcagctttatgagccctttgctt
atcttaatattggtatttccttctcttgtgcccatattggaaaaaatgaatctgagcctc
ttgtctaaagaaaatattgactttcttgtgaatgcatcacggcgtatcatagcagaccga
aaaaagagcaacagcagggatcgggtggatttcctgcaattaatgattgattcccaagtc
atgaatggctctagatctgaaaagaggaataactccccaaaagctctgactgaaatggag
attgttgctcaagcagttacgtttatttttgctggttatgaaactacaagtacaaccctc
aacttcatcacctataacttggccacccatcctgaaatccagaagaaactccttgaggag
atagatagcactctacccaacaaggcagtccccacctatgataccatcttccagatggaa
tatttggacatggtggtgaatgagacactcaggctcttccccctgggagggcgcatagag
agaatctgccaaaaaactgctgagatcaatgggataaccattcccaaagggacagtgatg
ttgatccctgtctatgttctgcatcatgacccagagtactggccagaacctgaagagttc
cgtcctgaaaggtttgatcaagaaggaagaaaatccatagacccatatgtattccttccc
tttggagctggacctcggaattgtgttggaatgaggtttgctctgctgaccttgaagact
gctctggtcaccctcttacagaattttacaatggagccttgcaaggagaccccgattccc
ttggaactagaaacaaagggttttatgcagcccaagaagccgatcatacttaagcttgtt
cctagaccaagacctgatgttgaggactag

DBGET integrated database retrieval system