KEGG   Monodelphis domestica (opossum): 100013118Help
Entry
100013118         CDS       T01031                                 

Definition
calcium-activated potassium channel subunit beta-3-like
Orthology
K04939  
potassium large conductance calcium-activated channel subfamily M beta member 3
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Vascular smooth muscle contraction
Insulin secretion
Class
Organismal Systems; Endocrine system; Insulin secretion [PATH:mdo04911]
Organismal Systems; Circulatory system; Vascular smooth muscle contraction [PATH:mdo04270]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
7
AA seq 295 aa AA seqDB search
MQPFIVPVQITLQGGRRRQGRSGCSASERWKKKDRGDGGSAADVPRKPPSSAGEDRAILL
GFVMMGFSVLMFFLLGVTILKPFLLSTQREEANCTIMDTRVKDDWLDCSFTCGVDCRGQG
KYPCLQVSVNLSHSGQKAFLHYNEEAVQINPECFYTPKCHRDRNDLLSSALDIKEFFDHK
NGTPFSCFYSPDGKPEDVVLIRKYDHTVVFHCVFWPSLTLLGGALIVGMVKLTQHLSVLC
DEYAHVVREDAGKAASQKELRPHRLEGLRKAARKWILHQAVTWSFGCEKRATNAF
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgcagccgttcatcgtccctgttcagatcacactgcagggcggccgaaggcgccaagga
aggtcaggctgctctgcttcagagaggtggaaaaagaaagaccgtggagatgggggttca
gccgcagatgtaccgagaaagcccccctccagtgcgggggaagatcgcgccatcctcctg
ggctttgtaatgatgggtttttcggttctgatgttttttttactcggagtcaccattcta
aaacctttcttgctcagcacacagcgagaagaggcaaactgtaccatcatggacacacgt
gtgaaggatgattggctggactgttcattcacctgcggggtggactgccggggccagggc
aagtacccttgcctccaggtgtccgtcaacctctcccattctggccagaaagcttttctg
cactataatgaagaagctgttcagataaacccagagtgcttctacacaccgaagtgccat
cgggataggaacgatctcctcagcagcgctctggacatcaaggaattcttcgaccacaaa
aacgggacccccttctcctgcttctacagccccgacggcaagcccgaggacgtggtcctg
ataagaaagtacgaccacacggtggtcttccactgcgtgttctggccgtcgctgacgctg
ctgggcggcgcgctgatcgtgggcatggtgaagctgacccagcacttgtcggtgctgtgc
gacgagtacgcccacgtggtgagagaggacgcgggcaaggccgcttcccagaaggaactg
cgcccgcacagactggagggcctgcgcaaggctgcccgcaagtggattctgcaccaggca
gtcacgtggtctttcgggtgtgaaaaaagggccacgaacgccttttag

DBGET integrated database retrieval system