KEGG   Monodelphis domestica (opossum): 100013384Help
Entry
100013384         CDS       T01031                                 

Gene name
EIF4E
Definition
(RefSeq) eukaryotic translation initiation factor 4E
  KO
K03259  translation initiation factor 4E
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo01521  EGFR tyrosine kinase inhibitor resistance
mdo03013  RNA transport
mdo04066  HIF-1 signaling pathway
mdo04150  mTOR signaling pathway
mdo04151  PI3K-Akt signaling pathway
mdo04211  Longevity regulating pathway
mdo04910  Insulin signaling pathway
Module
mdo_M00428  eIF4F complex
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100013384 (EIF4E)
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    100013384 (EIF4E)
   04151 PI3K-Akt signaling pathway
    100013384 (EIF4E)
   04150 mTOR signaling pathway
    100013384 (EIF4E)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100013384 (EIF4E)
  Aging
   04211 Longevity regulating pathway - mammal
    100013384 (EIF4E)
 Human Diseases
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    100013384 (EIF4E)
Messenger RNA biogenesis [BR:mdo03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     100013384 (EIF4E)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     100013384 (EIF4E)
Translation factors [BR:mdo03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    100013384 (EIF4E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IF4E
Motif
Other DBs
NCBI-GeneID: 100013384
NCBI-ProteinID: XP_007495968
Ensembl: ENSMODG00000020716
Position
5
AA seq 236 aa AA seqDB search
MRNLRDVAAFRGRWVGPPSHEAIKQETTTTPNPPPAEEEKTETNQEVANPEHYVKHPLQN
RWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEPM
WEDEKNKRGGRWLITLNKQQRRSDLDRFWLETLLCLIGESFDDYSDDVCGAVVNVRAKGD
KIAIWTTECENRDAVTHIGKVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFVV
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgagaaatttgagagacgttgctgcctttagaggtcgttgggttggtcccccttcacat
gaagccattaagcaggaaaccaccaccactcctaaccccccacctgcagaagaagaaaaa
actgaaaccaatcaggaggttgccaaccctgaacactacgtaaaacatccactacagaac
agatgggcactctggttttttaaaaatgataagagcaaaacttggcaagcaaaccttcgt
ctgatctctaagtttgatactgttgaggacttctgggctttatacaaccatatccagctg
tctagtaatttaatgcctggctgtgactactcactttttaaggatggaattgagcctatg
tgggaagacgaaaaaaacaaacgaggaggacgatggctaattacattaaataaacagcag
agacgaagtgaccttgatcgcttttggctagagacactgctgtgccttattggagagtca
tttgatgactacagtgatgatgtgtgtggagctgttgttaatgttagagctaaaggcgat
aagatagcaatatggactactgagtgtgaaaacagagatgctgttacacatatagggaag
gtatacaaggaaaggttaggacttcctccaaagatagtgattggttatcagtcccatgca
gacacagctactaagagcggctccaccactaaaaataggtttgttgtttaa

DBGET integrated database retrieval system