KEGG   Monodelphis domestica (opossum): 100013387Help
Entry
100013387         CDS       T01031                                 

Gene name
SETD1A
Definition
SET domain containing 1A
Orthology
K11422  
histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100013387 (SETD1A)
Enzymes [BR:mdo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100013387 (SETD1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
6
AA seq 1714 aa AA seqDB search
MDQEGGGDGQKPPNFQWRNYKLIVDPALHRLPQKVYRYDGIHFSVNDAGYKIVSKLQDPR
QRLTWSKNRDLSLPVPKFKLDEFYIGQVPLKEVTFARLNDNVRETFLKDMCRKYGEVEEV
EILLHPRTRKHLGLARVLFASTRGAKETVKHLHHTPVMGNIIHAQLDIKGQQRMKYYELI
VNGSYTPQTVPTEGKALNEKFQGSGIPTETTESRRRPSSDSAYPSSTSVPVTPGNGTPCS
QDTTFSSSRQDTPSSYGQFTPQSSQGTPYTSRGSTPYSQDSAYSSRQGTPGYSSYHPDSS
SSTTSSSYKPRRSENSYQDSYSRRHFSSSATTVASSSSSSSSSSSSSSSSTSSSSSSSSS
SSSSSSSSSSSSSSSSSHYRSSDSHYPAYFESSSRYQRHASYPPRRAPREESPATPFPER
FPPSYTSYLPPEPSRPADQDYRPPAPEAAPPEPPEPGGGGGGGASPEQEEARSSPRPASP
IRSCSPAPEITNESVPFAQHSSLDSRIEMLLKEQRSKFSFLASDTEEEEDSNSLGPGARE
TGSEVPLGPTHGPCTPPPAPANFEDVVPMGNIDPGTTGESPTANGQDQASLHSSGEDMEI
SDDDGGGSPPTAPSPPQPPPPPPPPPPPPPFLAPLPLGYPHQPAYLLPPRPEAPPPPEYP
PPPPPPPHIYDFVNSLELMDRLGAQWGGMPMSFQMQTQMLTRLHQLRQGTGVTAASAAPP
SGGFGEHFLPFPPHQEAAYTLPYTLYTPGQESRGSYARETYHLPLQAEPLPSSSALGEEE
HPTPGEDVELTEGKVPPPAGTVGRVLATLVQEMKNIMQRDLNRKMVENVAFGAFDQWWES
KEEKAKPFQNAAKQQAKEEDKEKTKLKEPGLLSLVDWAKSGGATGLEGFGFGSGLRGALR
LPSFKVKRKEPSEISEGGEEKRPRPSTPAEEDDDEPDRDKEAGESSRPVMKGSKREEERS
KAQGKHRKPFALDSEGEEASQESSSDKDEEDEEEEEEEEEHSETMEASKKEAEASGGEDE
ESASSSKYSPYPESEGENDSTSDSESGSSSSSSSSSPSSSSSSSSSSASEEEEEEPPVVS
SALSPSRDIPSDLPVSVEEPEQEKTSVSPVMPISELEKAPVRPLGPPEEPLPETLQHPPE
PPAVPQASPPLPLASRPEECPSSPIPLLPPPKKRRKTVSFSASEETPTTPIPEVPPPVPP
PAKPLGPLSRKISRVGDRTIRNLPLDHASLVKSWPEDGSRMGRNRSGGRGRLPEEEEPGT
EVDLAVLADLALTPAPARRGLVALPVGDDSEATETSDEAERSGPTVPSVIHVLLEHNYAL
AVRPAPPTPVSRPLEPLPSPATVFSSPADEVLEAPEVVVAEVEEEEEGGEEEEEEEEEEE
ESSESSSSSSDGEGALRRRSLRSHARHRRQPLPPAPPPPPSYEPRSEFEQMTILYDIWNS
GLDAEDMGYLRLTYERLLQQDSGADWLNDTHWVHHTITNLTTPKRKRKPFDGPREHQTGS
ARSEGYYPISKKEKDKYLDVCPVSARQLEGSDTQGTNRVLSERRSEQRRLLSAIGTSAIV
DSDLLKLNQLKFRKKKLRFGRSRIHEWGLFAMEPIAADEMVIEYVGQNIRQVVADMREKR
YVQEGIGSSYLFRVDHDTIIDATKCGNLARFINHCCTPNCYAKVITIEAQKKIVIYSKQP
IGVDEEITYDYKFPLEDNKIPCLCGTESCRGSLN
NT seq 5145 nt NT seq  +upstreamnt  +downstreamnt
atggaccaggaaggagggggagatgggcaaaagccccccaacttccagtggagaaactac
aaactcattgtggaccctgcactgcaccgactcccacagaaggtttaccgctatgatgga
attcatttcagtgttaatgatgcaggttacaagattgtcagcaagctccaagacccccgt
caacgactcacctggtctaaaaacagggacctttcccttccagttcctaagtttaagctt
gatgagttctacattgggcaggtcccactgaaggaagtgacctttgcccggctgaatgac
aacgttcgagagaccttcctgaaggacatgtgccgcaagtatggagaggtggaggaggtg
gagatcctgttgcacccccgaacccgaaagcatctaggcctagcccgagtgctctttgcc
agcactcggggtgccaaagagaccgtaaaacacctccatcacaccccggtcatgggcaat
atcatccacgcccagcttgacatcaaaggacaacaacggatgaaatactatgaattgatt
gtcaatggctcctatacccctcaaacagtacccacagagggcaaagccttaaatgagaag
ttccaaggatctggaatacccactgagacgacggaatctcgacgccggccttcatctgat
tcagcctacccatcaagcacttctgtgccagtcacacctggcaatggcacaccctgctct
caggacacaactttctctagtagccggcaagacaccccttcctcttatggccagttcacg
ccacaatcctctcaagggacgccttatacctctcggggcagcaccccatattcccaggac
tctgcctattccagcaggcaaggaactcctggctattccagttaccatccagattcctct
tcttctaccacctcttcttcctataaacctcgtcggtcagagaacagctatcaggactcc
tattcccgccgtcatttctcttcttcagctaccactgttgcctcttcttcatcgtcatcc
tcatcatcatcctcatcatcatcttcatcaacgtcatcatcctcttcctcttcctcctcc
tcctcctcttcttcttcctcctcctcttcctcctcctcctcctcttcctcacattaccgt
agttctgactcacattatccagcatattttgagagcagtagccgataccagcgccatgct
tcctacccaccccgacgtgcaccccgggaggagtccccagcaacccctttccctgagcgc
ttcccaccctcctacacctcctaccttcctcccgagcccagtcgccctgctgaccaggac
tatcgacctcctgccccagaggctgcacctccagagcctccggaacctggtggtggagga
ggtgggggagccagccctgaacaagaggaagccagaagttcacctcgaccagcatctcct
attcgatcttgctcacctgctccagagatcaccaatgagagtgtaccctttgcccagcac
agcagcctagattccaggattgaaatgttgctgaaggaacaacgatccaagttctccttc
ttggcctcagacacagaagaagaagaagacagcaatagtttgggccctggggctagagaa
actgggagtgaggtccccctaggaccaactcatgggccttgcacacctcccccagcacct
gcaaattttgaggatgtcgttcctatggggaacattgatcctgggactactggagagtct
cccacagcaaatggacaggaccaggcctctcttcattcttcaggcgaggacatggaaatc
tcagatgatgatggtggaggatcacccccaacagccccttcaccaccacaaccaccacca
cctcctcctcctccccctccccctcccccctttctggctcctcttcccctgggctatccc
catcagcctgcctacctccttccaccccggccagaggcccctccaccccctgagtatcct
cctcctcctccccctcccccccacatctatgactttgtcaactcccttgagctgatggac
cgacttggggctcagtggggagggatgcccatgtccttccagatgcagacccaaatgttg
accaggttgcaccagctgcggcaaggtacaggggtaactgctgcatcagcagccccgcct
agtggaggttttggcgagcattttcttccattccctccacatcaagaagctgcctacaca
ctaccctatactctgtatacccctggacaggagagccgagggtcttatgcccgtgagacg
tatcacctgcccttgcaggcagagcccttgccttcatcctctgccctaggagaggaggaa
cacccaactcctggggaagatgtagaactgacagaggggaaggtaccacctcctgctggc
acagtgggtcgggtgctggctaccctagtgcaagagatgaagaacatcatgcagcgagac
cttaatcgcaaaatggtggaaaatgtagcttttggagcttttgaccagtggtgggaaagt
aaagaggaaaaggctaagcctttccagaatgcagccaagcagcaggcaaaagaggaagac
aaggaaaagacaaaattaaaggagcctgggctgctctcccttgtggactgggccaagagt
gggggtgctacagggcttgagggctttggatttggctctgggcttcgaggagcacttcga
ctaccttcattcaaggtaaagcggaaagagccatctgaaatttcagagggtggtgaagag
aaacggcctaggccttctaccccagctgaagaggatgatgatgagcctgatcgagataag
gaagctggagaatcaagtcgtccagtgatgaagggctcaaagcgggaagaggaaaggagt
aaggcccagggcaaacaccgaaaaccttttgctctagatagtgaaggggaagaggcatct
caagagtcctcctctgacaaggatgaagaagatgaggaggaggaggaggaggaggaagag
cacagtgaaaccatggaggccagtaagaaggaggcagaggcatctggaggtgaggatgaa
gaaagtgcatcctcctccaagtattctccgtatcctgaatcagaaggtgagaatgacagc
acttcagactctgagagtggcagctcctctagcagctcttcttcaagcccttcttcatca
tcctcttcctcatcttcctctgcatctgaagaagaggaagaggagccaccagtggtttct
tcagccttgtcaccctctcgagacatcccatcagaccttcctgtttctgtggaagagcca
gaacaagagaagacttcagtctcacctgtaatgcctatctctgagctggagaaggcccca
gtgaggcctctaggtcctcctgaggagccactgcctgagacccttcagcatcccccagaa
ccaccagctgtcccccaagcctctcctcccctacctcttgcatctcgtcctgaggagtgt
ccatcttctcctatcccacttctcccaccaccgaagaagcgccggaaaacagtctccttc
tctgcatcagaggaaaccccaaccaccccaatccctgaggttcccccacctgttccacct
ccagctaagcctcttggtcccctttcccgaaaaatttcccgggttggggatcggaccatt
cgaaatctgcccctggaccatgcttctttggtcaagagctggccagaggatggatcccgg
atgggacggaaccggagtggaggtcggggtcgtctgccagaagaagaagaaccagggact
gaagtagacctagcagtattggcagatttggccctcactccagctccagctcgtcgaggg
ctggttgctctacctgtaggggatgattctgaggccacagaaacctcagatgaggctgag
cgttcagggccaacagttccctcagttattcacgttcttctggagcataactatgctctg
gctgtccgacctgctcccccaaccccagtttccagacccctggaaccacttccttctcct
gccactgtcttcagctcacctgctgatgaggttctagaagctcctgaggtggtggttgct
gaggtggaggaagaggaagaggggggggaggaagaagaagaggaggaggaggaggaggag
gagtcatctgaaagtagtagcagtagcagtgatggggagggagctttgaggcgaaggagc
cttcgatcccatgccaggcaccgtcgacagcccctgccacctgcccctccacccccaccc
agctatgagccccgaagtgagtttgagcagatgaccatcttgtacgacatctggaattcc
gggcttgatgccgaagacatgggctacttaagactcacatatgagaggctgctacagcag
gacagtggagctgactggcttaatgatacccactgggtccatcataccatcaccaacttg
accactcccaaacgtaagagaaagcccttcgatgggccccgagagcatcagactggctca
gctcgaagcgagggctactaccccatcagtaagaaagaaaaggataagtacttggatgtc
tgtcctgtctctgcacgtcaactagagggctcagacacccaggggacaaaccgagtgcta
tcagaaagaaggtcagagcagagaaggctactgagtgccattggcacatcagccattgtg
gatagtgacctgctaaaattaaatcagctcaagttccggaagaaaaaactacgatttggc
aggagtcggatccatgagtggggtctttttgcaatggagcccattgcggctgatgagatg
gttatagagtatgtgggacagaacatacgtcaggtggtggctgatatgcgggagaaacga
tatgtgcaggagggcattggcagtagctatctgttccgagtggaccatgacaccatcatt
gatgccacaaaatgtggcaacctggcacgatttatcaatcactgctgcacgcccaactgt
tatgccaaggtgatcaccattgaagcccagaagaagattgtaatctactccaagcagcct
attggggtggatgaagagatcacctatgactacaaattccccttggaagacaacaaaatc
ccatgtttgtgtggcactgaaagttgccggggttccctcaactaa

DBGET integrated database retrieval system