KEGG   Monodelphis domestica (opossum): 100013390Help
Entry
100013390         CDS       T01031                                 

Gene name
EZH2
Definition
enhancer of zeste homolog 2 (Drosophila)
Orthology
K11430  
histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    100013390 (EZH2)
Enzymes [BR:mdo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100013390 (EZH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
8
AA seq 747 aa AA seqDB search
MGQTGKKSEKGPVCWRKRVKSEYMRLRQLKRFRRADEVKSMFNSNRQKILERTEILNQEW
KQRRIQPVHIMTSVSSLRGTRECSVTSDLDFPKQVIPLKTLNAVASVPIMYSWSPLQQNF
MVEDETVLHNIPYMGDEVLDQDGTFIEELIKNYDGKVHGDRECGFINDEIFVELVNALGQ
YSDDEDDDDGDDPDLRDEKQKDLEDNRDDDKESHPPRKFPSDKIFEAISSMFPDKGTSEE
LKEKYKELTEQQLPGALPPECTPNIDGPNAKSVQREQSLHSFHTLFCRRCFKYDCFLHPF
HATPNTYKRKNTETALDNKPCGPHCYQHLEGAKEFAAALTAERIKTPPKRPGGRRRGRLP
NNSSRPSTPTINVLESKDTDSDREAGTETGGENNDKEEEEKKDETSSSSEANSRCQTPIK
MKPNIEPPENVEWSGAEASMFRVLIGTYYDNFCAIARLIGTKTCRQVYEFRVKESSIIAP
VPAEDVDTPPRKKKRKHRLWAAHCRKIQLKKDGSSNHVYNYQPCDHPRQPCDSSCPCVIA
QNFCEKFCQCSSECQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCLTCGAADHWDSKNV
SCKNCSIQRGSKKHLLLAPSDVAGWGIFIKDPVQKNEFISEYCGEIISQDEADRRGKVYD
KYMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVMMVNGDHRIGIFAKRAIQTG
EELFFDYRYSQADALKYVGIEREMEIP
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atgggccagactggaaagaaatccgagaagggaccagtttgttggcggaagcgcgtaaaa
tctgaatacatgagactgaggcagctcaagaggttcagacgagctgatgaagtaaagagt
atgtttaattctaatcggcagaagattctagaaaggacagaaatcttaaaccaagaatgg
aaacagcgaaggatacagcctgtacacatcatgacttctgtgagctcattgcgcgggacc
agggagtgttctgtgaccagtgatttggattttccaaagcaagtcatcccattaaagact
ttgaatgctgttgcttcagtacctataatgtattcttggtctcccctacagcagaatttt
atggtggaagatgagacagttttacataacattccttatatgggggatgaagtccttgat
caggatggaactttcattgaagaattaattaaaaattatgatgggaaagtacatggagat
agagaatgtgggtttataaatgatgagatttttgtggagttggtgaatgctcttggtcaa
tacagtgatgatgaagatgatgatgatggggatgatcctgatttgagagatgaaaaacaa
aaagatttagaggataacagagatgatgataaagaaagccacccacctcggaaatttcct
tctgacaagatttttgaagccatttcctcaatgtttcctgataagggaacatcagaagag
ctaaaggagaagtacaaagaactaacagagcagcaacttccaggagcccttcctcctgaa
tgtacaccaaacatagatggaccaaatgccaagtctgttcagagggagcaaagcctgcac
tcatttcatactctcttctgcaggcgctgctttaaatatgactgtttcttacatccattc
catgcaacacccaacacttataagcggaagaacacagaaacagcactagataataaacct
tgtggaccacactgttaccagcatttggaaggggcaaaagagtttgctgctgctctcact
gcagagcgaatcaagaccccacctaagcgcccaggaggtcgtcgaagaggaaggcttcca
aataacagcagtagacccagcacaccaactattaacgtgctggaatcaaaggatacagac
agtgatagggaagctgggactgaaacagggggagaaaataatgataaggaggaggaagaa
aagaaagatgaaacttccagctcttctgaggcaaactccaggtgtcaaacgccaatcaaa
atgaagccaaatattgaacctcctgagaatgtggaatggagtggtgctgaagcctcaatg
ttcagagttcttattggcacttactatgataatttttgtgccattgctaggttgattggg
accaaaacatgtagacaggtctatgagtttagagtaaaggaatctagtattatagctcca
gttcctgctgaggatgttgatacgcctccaagaaagaaaaaaaggaaacaccggttgtgg
gctgcacattgcagaaagatacaactgaaaaaggatggctcctctaaccatgtttacaac
tatcaaccctgtgatcatccacgtcagccttgtgacagttcttgcccatgcgtgattgct
caaaacttttgtgagaagttttgtcagtgtagctcagaatgccaaaacagattccctggg
tgccgctgtaaagcacaatgcaacactaaacagtgcccttgctatctggctgtgcgtgag
tgtgatccagacctctgtctcacatgtggggctgcggatcactgggacagcaaaaacgtg
tcctgcaagaactgtagcatacagagaggatccaaaaagcatttactgttggcaccatct
gatgtggcaggttggggaattttcatcaaagatcctgtgcaaaagaatgaattcatctct
gaatactgtggtgagatcatttctcaggatgaggctgacagaagaggaaaagtttatgat
aagtacatgtgcagctttctcttcaacttgaataacgattttgtggtggatgcaactcgt
aagggtaacaaaattcgttttgcaaatcattcagtaaatcccaactgctatgcaaaagtt
atgatggttaacggtgatcacaggataggtatttttgctaagagagccatccagactggt
gaagagctgttttttgactacagatatagccaggctgatgccctgaagtatgtgggcatt
gaaagagaaatggaaatcccttga

DBGET integrated database retrieval system