KEGG   Monodelphis domestica (opossum): 100013612Help
Entry
100013612         CDS       T01031                                 

Gene name
USP25
Definition
ubiquitin specific peptidase 25
Orthology
K11849  
ubiquitin carboxyl-terminal hydrolase 25/28 [EC:3.1.2.15]
Organism
mdo  Monodelphis domestica (opossum)
Brite
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100013612 (USP25)
Peptidases [BR:mdo01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100013612 (USP25)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 685 aa AA seqDB search
MTVEQNVLQQSTSQKHQQTFLNQLREITGINDTQILQQALKDSNGNLELAVAFLTAKNAK
TPQQEEATYYQTALPGNDRYISVGSQADTNVIDLTGDDKDDLQRAIALSLEESNRAFRET
GITDEEQAISRVLEASIAENKASLKRTHTEVWNDSPNPHDRKRQDNCPVGLKNVGNTCWF
SAVIQVKPLCTLHRKPARLPVFLISRLEKPRRGGAEEHLLPLFSCFRFLVFRNRLAYHFI
TFFIRLSGALTSSFENGLFVAFGHGSIGERLWLPLYRQTLFNVTSSPSAPGYAPAEEPEY
LEQPSRSDVTKYLKEETMRAITKASLEHEDKNPETVLQLPPEKATSPPPSKQPAVEVALA
PVGTFAVASEKGGDDNEIMMTPDMQGIIMALAQSRSVYDRCGPEAGFLKAIKLEYARLLK
LAQEDAPPERDYRLQHAVVYFIQNQSPKRIIERTLLEQFGNRTLSFDERCRNIMKIAQAK
LEMIKPEEVNMEEYEKWHQDYRSFRDTTAYLTVGLEHFQTKSYVEAILYLICAYQHNKEL
LSKGPYRGHDEELLSHYRRECLLKLNEHAAELFESGDDQEVNNGLIIMNELIVPCLPLLL
VDEMEEKDIVAVEDMRNRWCSYLGQEMESRLQEKLTDFLPKLLDCSTEMKGFSEPPKLPP
CSTHELCERFARIMLSLSRTPADGR
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtggagcagaatgtgctgcagcaaagcacctcccagaagcaccagcagacgttt
ttgaatcagctcagagaaatcaccggcatcaatgacacgcagatactgcagcaagccttg
aaggatagcaacggaaacttggaattagctgtggctttcctgaccgcgaagaatgccaag
acacctcagcaagaggaagcgacttactatcaaacagcccttcctggcaatgatagatac
atcagtgtgggaagccaagcagatacaaatgtgattgatctcactggagatgataaagat
gatcttcagagagcaattgccttgagtttggaagaatcaaacagggctttcagggagact
ggaataactgatgaggagcaagctattagcagagtcctggaagccagcatcgcggagaac
aaggccagcctgaagaggacgcacacggaggtctggaacgattctccaaatccccacgac
cggaaaaggcaggacaactgccccgtggggctgaagaacgtgggcaacacgtgctggttc
agtgccgtcatccaggtaaagcctttgtgcacgctccatcggaagccggcgaggcttcct
gtgtttctgatcagtcgtctggagaagccacgtcgtggtggtgctgaggagcacctcttg
ccgctcttctcctgctttcgcttcctggttttccgaaatcgtcttgcttaccatttcata
acatttttcattcgactctcgggagctttgacttcttcatttgaaaacggcctcttcgtg
gccttcggccatggatccatcggagaacgactgtggcttcctttgtacagacagacgctt
tttaatgtgacgtcatcaccatcagcccccggttacgctcctgcagaagaaccggaatac
ctagagcagccctcaagaagtgatgtcaccaagtatttgaaagaagagaccatgcgagcc
atcaccaaggcatcgttagagcatgaagataaaaaccctgaaaccgttttacagctgccc
cctgaaaaagccaccagccccccaccttctaagcagcccgctgtagaggtggcactcgct
cctgtagggacctttgcggtcgcctcagagaaggggggtgatgacaatgagatcatgatg
acgcccgacatgcaaggtattatcatggctctggctcaatcgaggagtgtgtatgacagg
tgtggccctgaagcagggttcttgaaggccatcaaactggagtacgcccggctcctgaag
ctggctcaggaggacgcgcccccggagcgagactaccgcctgcagcacgccgtggtctat
ttcatccagaaccaatcgcccaagagaatcattgagaggaccttgttggaacagtttgga
aaccgcactttgagttttgacgaacggtgtcgcaacatcatgaaaattgctcaagctaaa
cttgaaatgataaagccagaagaagtaaacatggaagaatacgagaagtggcaccaggac
tacaggagcttccgagacaccacagcctatctcacggtaggcctcgagcacttccagacc
aagagttatgtagaagccatactgtatctcatctgtgcttaccagcataacaaggagctc
ttgtccaagggtccctaccgagggcacgatgaagagctgctgtcacattaccgaagagag
tgtttgctgaagctaaacgagcatgctgcggagctctttgaatctggagatgatcaagaa
gtgaacaatggattgataattatgaatgagttgattgtcccgtgtttgccgttgttgctg
gtggatgagatggaagagaaggatatagttgctgtagaagatatgagaaatcgctggtgt
tcgtatctcggacaagaaatggaatcccgcctccaggaaaagctgactgacttcctgccc
aaactgctcgattgctctacggagatgaaaggtttcagcgagccgccgaaattacctccc
tgctcgacacacgaactgtgtgaacgctttgcccgaatcatgttgtccctcagtcgaacg
cccgctgatggaagataa

DBGET integrated database retrieval system