KEGG   Monodelphis domestica (opossum): 100013612Help
Entry
100013612         CDS       T01031                                 

Definition
ubiquitin carboxyl-terminal hydrolase 25-like
Orthology
K11849  
ubiquitin carboxyl-terminal hydrolase 25/28 [EC:3.1.2.15]
Organism
mdo  Monodelphis domestica (opossum)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 679 aa AA seqDB search
MPRGGDDSASCGVPAHGPRASPWARWGLGDPRAPAQEGMHQQTFLNQLREITGINDTQIL
QQALKDSNGNLELAVAFLTAKNAKTPQQEEATYYQTALPGNDRYISVGSQADTNVIDLTG
DDKDDLQRAIALSLEESNRAFRETGITDEEQAISRVLEASIAENKASLKRTHTEVWNDSP
NPHDRKRQDNCPVGLKNVGNTCWFSAVIQAVLMSVAFEMGYRKAASWEIESTPELPSSAA
LLSSATTGITFTTDSTGCSLHHSLPPPPRRLEKPRRGGAEEHLLPLFSCFRFLVFRNRLA
YHFITFFIRLSGALTSSFENGLFVAFGHGSIGERLWLPLYRQTLFNVTSSPSAPGYAPAE
EPEYLEQPSRSDVTKYLKEETMRAITKASLEHEDKNPETVLQLAIKLEYARLLKLAQEDA
PPERDYRLQHAVVYFIQNQSPKRIIERTLLEQFGNRTLSFDERCRNIMKIAQAKLEMIKP
EEVNMEEYEKWHQDYRSFRDTTAYLTVGLEHFQTKSYVEAILYLICAYQHNKELLSKGPY
RGHDEELLSHYRRECLLKLNEHAAELFESGDDQEVNNGLIIMNELIVPCLPLLLVDEMEE
KDIVAVEDMRNRWCSYLGQEMESRLQEKLTDFLPKLLDCSTEMKGFSEPPKLPPCSTHEL
CERFARIMLSLSRTPADGR
NT seq 2040 nt NT seq  +upstreamnt  +downstreamnt
atgccaagaggtggagacgactccgcctcctgcggcgtccccgcccacgggccccgcgcc
tccccttgggctcggtggggacttggagacccccgtgctcccgcgcaggaggggatgcac
cagcagacgtttttgaatcagctcagagaaatcaccggcatcaatgacacgcagatactg
cagcaagccttgaaggatagcaacggaaacttggaattagctgtggctttcctgaccgcg
aagaatgccaagacacctcagcaagaggaagcgacttactatcaaacagcccttcctggc
aatgatagatacatcagtgtgggaagccaagcagatacaaatgtgattgatctcactgga
gatgataaagatgatcttcagagagcaattgccttgagtttggaagaatcaaacagggct
ttcagggagactggaataactgatgaggagcaagctattagcagagtcctggaagccagc
atcgcggagaacaaggccagcctgaagaggacgcacacggaggtctggaacgattctcca
aatccccacgaccggaaaaggcaggacaactgccccgtggggctgaagaacgtgggcaac
acgtgctggttcagtgccgtcatccaggctgttctcatgtctgttgctttcgaaatgggc
taccgcaaagccgcttcctgggagatcgaatccactccagaacttccttcctcggccgcg
ctcctctctagcgccaccacaggaatcaccttcaccacagactccacaggctgctctctg
caccacagcctcccacccccaccccgtcgtctggagaagccacgtcgtggtggtgctgag
gagcacctcttgccgctcttctcctgctttcgcttcctggttttccgaaatcgtcttgct
taccatttcataacatttttcattcgactctcgggagctttgacttcttcatttgaaaac
ggcctcttcgtggccttcggccatggatccatcggagaacgactgtggcttcctttgtac
agacagacgctttttaatgtgacgtcatcaccatcagcccccggttacgctcctgcagaa
gaaccggaatacctagagcagccctcaagaagtgatgtcaccaagtatttgaaagaagag
accatgcgagccatcaccaaggcatcgttagagcatgaagataaaaaccctgaaaccgtt
ttacagctggccatcaaactggagtacgcccggctcctgaagctggctcaggaggacgcg
cccccggagcgagactaccgcctgcagcacgccgtggtctatttcatccagaaccaatcg
cccaagagaatcattgagaggaccttgttggaacagtttggaaaccgcactttgagtttt
gacgaacggtgtcgcaacatcatgaaaattgctcaagctaaacttgaaatgataaagcca
gaagaagtaaacatggaagaatacgagaagtggcaccaggactacaggagcttccgagac
accacagcctatctcacggtaggcctcgagcacttccagaccaagagttatgtagaagcc
atactgtatctcatctgtgcttaccagcataacaaggagctcttgtccaagggtccctac
cgagggcacgatgaagagctgctgtcacattaccgaagagagtgtttgctgaagctaaac
gagcatgctgcggagctctttgaatctggagatgatcaagaagtgaacaatggattgata
attatgaatgagttgattgtcccgtgtttgccgttgttgctggtggatgagatggaagag
aaggatatagttgctgtagaagatatgagaaatcgctggtgttcgtatctcggacaagaa
atggaatcccgcctccaggaaaagctgactgacttcctgcccaaactgctcgattgctct
acggagatgaaaggtttcagcgagccgccgaaattacctccctgctcgacacacgaactg
tgtgaacgctttgcccgaatcatgttgtccctcagtcgaacgcccgctgatggaagataa

DBGET integrated database retrieval system