KEGG   Monodelphis domestica (opossum): 100013612Help
Entry
100013612         CDS       T01031                                 

Gene name
USP25
Definition
(RefSeq) ubiquitin specific peptidase 25
  KO
K11849  
ubiquitin carboxyl-terminal hydrolase 25/28 [EC:3.4.19.12]
Organism
mdo  Monodelphis domestica (opossum)
Brite
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100013612 (USP25)
Peptidases [BR:mdo01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100013612 (USP25)
Ubiquitin system [BR:mdo04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    100013612 (USP25)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
4
AA seq 612 aa AA seqDB search
MTVEQNVLQQSTSQKHQQTFLNQLREITGINDTQILQQALKDSNGNLELAVAFLTAKNAK
TPQQEEATYYQTALPGNDRYISVGSQADTNVIDLTGDDKDDLQRAIALSLEESNRAFRET
GITDEEQAISRVLEASIAENKASLKRTHTEVWNDSPNPHDRKRQDNCPVGLKNVGNTCWF
SAVIQVKPLCTLHRKPARLPVFLIRCMCTCVRVWRRVCGAPAEEPEYLEQPSRSDVTKYL
KEETMRAITKASLEHEDKNPETVLQLPPEKATSPPPSKQPAVEVALAPVGTFAVASEKGG
DDNEIMMTPDMQGIIMALAQSRSVYDRCGPEAGFLKAIKLEYARLLKLAQEDAPPERDYR
LQHAVVYFIQNQSPKRIIERTLLEQFGNRTLSFDERCRNIMKIAQAKLEMIKPEEVNMEE
YEKWHQDYRSFRDTTAYLTVGLEHFQTKSYVEAILYLICAYQHNKELLSKGPYRGHDEEL
LSHYRRECLLKLNEHAAELFESGDDQEVNNGLIIMNELIVPCLPLLLVDEMEEKDIVAVE
DMRNRWCSYLGQEMESRLQEKLTDFLPKLLDCSTEMKGFSEPPKLPPCSTHELCERFARI
MLSLSRTPADGR
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtggagcagaatgtgctgcagcaaagcacctcccagaagcaccagcagacgttt
ttgaatcagctcagagaaatcaccggcatcaatgacacgcagatactgcagcaagccttg
aaggatagcaacggaaacttggaattagctgtggctttcctgaccgcgaagaatgccaag
acacctcagcaagaggaagcgacttactatcaaacagcccttcctggcaatgatagatac
atcagtgtgggaagccaagcagatacaaatgtgattgatctcactggagatgataaagat
gatcttcagagagcaattgccttgagtttggaagaatcaaacagggctttcagggagact
ggaataactgatgaggagcaagctattagcagagtcctggaagccagcatcgcggagaac
aaggccagcctgaagaggacgcacacggaggtctggaacgattctccaaatccccacgac
cggaaaaggcaggacaactgccccgtggggctgaagaacgtgggcaacacgtgctggttc
agtgccgtcatccaggtaaagcctttgtgcacgctccatcggaagccggcgaggcttcct
gtgtttctgatcaggtgcatgtgcacatgtgtgcgtgtgtggaggcgtgtgtgtggagct
cctgcagaagaaccggaatacctagagcagccctcaagaagtgatgtcaccaagtatttg
aaagaagagaccatgcgagccatcaccaaggcatcgttagagcatgaagataaaaaccct
gaaaccgttttacagctgccccctgaaaaagccaccagccccccaccttctaagcagccc
gctgtagaggtggcactcgctcctgtagggacctttgcggtcgcctcagagaaggggggt
gatgacaatgagatcatgatgacgcccgacatgcaaggtattatcatggctctggctcaa
tcgaggagtgtgtatgacaggtgtggccctgaagcagggttcttgaaggccatcaaactg
gagtacgcccggctcctgaagctggctcaggaggacgcgcccccggagcgagactaccgc
ctgcagcacgccgtggtctatttcatccagaaccaatcgcccaagagaatcattgagagg
accttgttggaacagtttggaaaccgcactttgagttttgacgaacggtgtcgcaacatc
atgaaaattgctcaagctaaacttgaaatgataaagccagaagaagtaaacatggaagaa
tacgagaagtggcaccaggactacaggagcttccgagacaccacagcctatctcacggta
ggcctcgagcacttccagaccaagagttatgtagaagccatactgtatctcatctgtgct
taccagcataacaaggagctcttgtccaagggtccctaccgagggcacgatgaagagctg
ctgtcacattaccgaagagagtgtttgctgaagctaaacgagcatgctgcggagctcttt
gaatctggagatgatcaagaagtgaacaatggattgataattatgaatgagttgattgtc
ccgtgtttgccgttgttgctggtggatgagatggaagagaaggatatagttgctgtagaa
gatatgagaaatcgctggtgttcgtatctcggacaagaaatggaatcccgcctccaggaa
aagctgactgacttcctgcccaaactgctcgattgctctacggagatgaaaggtttcagc
gagccgccgaaattacctccctgctcgacacacgaactgtgtgaacgctttgcccgaatc
atgttgtccctcagtcgaacgcccgctgatggaagataa

DBGET integrated database retrieval system