KEGG   Monodelphis domestica (opossum): 100013711Help
Entry
100013711         CDS       T01031                                 

Gene name
PRKAA1
Definition
protein kinase, AMP-activated, alpha 1 catalytic subunit
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
FoxO signaling pathway
Regulation of autophagy
mTOR signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Circadian rhythm
Insulin signaling pathway
Adipocytokine signaling pathway
Oxytocin signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    100013711 (PRKAA1)
   04151 PI3K-Akt signaling pathway
    100013711 (PRKAA1)
   04152 AMPK signaling pathway
    100013711 (PRKAA1)
   04150 mTOR signaling pathway
    100013711 (PRKAA1)
 Cellular Processes
  Transport and catabolism
   04140 Regulation of autophagy
    100013711 (PRKAA1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100013711 (PRKAA1)
   04920 Adipocytokine signaling pathway
    100013711 (PRKAA1)
   04921 Oxytocin signaling pathway
    100013711 (PRKAA1)
  Environmental adaptation
   04710 Circadian rhythm
    100013711 (PRKAA1)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    100013711 (PRKAA1)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100013711 (PRKAA1)
Enzymes [BR:mdo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100013711 (PRKAA1)
Protein kinases [BR:mdo01001]
 Serine/threonine protein kinases: CAMK group
  CAMKL family
   100013711 (PRKAA1)
Mitochondrial biogenesis [BR:mdo03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    100013711 (PRKAA1)
  Mitophagy factors
   Other mitophagy factors
    100013711 (PRKAA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
3
AA seq 559 aa AA seqDB search
MRRLSSWRKMAAAEKQKHDGRVKIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNR
QKIRSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMVMEYVSGGELFDYICKNG
RLDEKESRRLFQQILSGVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEF
LRTSCGSPNYAAPEVISGRLYAGPEVDIWSSGVILYALLCGTLPFDDDHVPTLFKKICDG
IFYTPQYLNPSVISLLKHMLQVDPMKRATIKDIREHEWFKQDLPKYLFPEDPSYSSTMID
DEALKEVCEKFECTEEEVLSCLYSRNHQDPLAVAYHLIIDNRRIMNEAKDFYLATSPPDS
FLDDHHFSRPHPERVPFLVAETPRSRHTLDELNPQKSKHQGVRRAKWHLGIRSQSRPNDI
MAEVCRSIKQLDYEWKVVNPYYLRVRRKNPVTSTYSKMSLQLYQVDSRTYLLDFRSIDDE
ITEAKSGTTTPQRSGSVSNYRSCQKNDSDAEAQGRSSDVSLTSSVTSLDSSTVDLTPRPG
SHTIEFFEMCANLIKILAQ
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaggctcagttcctggaggaagatggcggcagcggagaagcagaaacacgacggg
cgggtgaagatcggccactacatcctaggagacacgctcggggtcggcactttcggcaaa
gtgaaggttggcaagcatgagttgactgggcacaaagttgctgtgaagatcttgaatcga
cagaaaatccgaagccttgatgtggtagggaaaattcgcagagaaatccagaacctcaag
cttttcagacatcctcatatcatcaagctgtatcaggtcattagtacaccatctgacatt
ttcatggtaatggaatatgtgtccggtggagagctgtttgattatatttgtaaaaatgga
aggctggatgaaaaagaaagtcggcgtttattccaacaaatcctttctggtgtggattat
tgtcatagacacatggttgtccatagagatttgaaacctgaaaatgtactgcttgatgca
cacatgaatgcaaagatagctgattttggtctttcaaatatgatgtcagatggcgaattt
ttaagaacaagctgtggctctcccaactatgctgcaccagaagtaatttcaggaaggttg
tatgcaggtccagaggtagatatttggagcagtggtgtcattctttatgctttattatgt
ggcacccttccttttgatgatgatcatgtgccaaccctttttaagaagatatgtgatggg
atcttttatacccctcagtacttgaatccttctgtgattagccttctgaaacatatgctg
caggtggatcccatgaagagagccacaatcaaagacatcagggaacatgagtggtttaag
caagaccttccaaagtatctctttcctgaggatccatcatatagttcaaccatgattgat
gacgaagccttaaaagaagtatgtgaaaaatttgaatgtacagaagaagaggttctcagc
tgtctgtatagcagaaaccatcaggaccctttggcagttgcttatcacctcataatagat
aacaggagaataatgaatgaggccaaagatttctacttggctacaagcccaccagattct
ttcttagatgaccaccatttttctcgcccacatcctgaaagagtgccattcttggttgct
gaaacaccaaggtcacgtcatactttggatgaattgaatcctcaaaagtccaaacaccag
ggtgttaggagggcaaagtggcatttgggaattcgaagtcaaagtcgaccaaatgatatc
atggcagaagtttgtcgctcaattaaacaactggattatgaatggaaggttgtaaaccct
tactatttgcgtgttcgaaggaagaatccagtgacaagcacatactcaaaaatgagtcta
cagttatatcaggttgacagtaggacttacttactggacttccgaagcattgatgatgaa
attaccgaagccaaatctggaactactactcctcaaagatcaggttctgtgagcaattat
cgatcttgccaaaagaatgattcagatgctgaagcccaaggaagatcctcagatgtttcc
cttacctcatcagttacttcacttgactcttcaacagttgacttaaccccaaggccagga
agtcacacaatagagttttttgagatgtgtgcaaatcttattaaaattcttgcacagtaa

DBGET integrated database retrieval system