KEGG   Monodelphis domestica (opossum): 100013718Help
Entry
100013718         CDS       T01031                                 

Definition
lysozyme C-like
Orthology
K13915  
lysozyme C [EC:3.2.1.17]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Salivary secretion
Class
Organismal Systems; Digestive system; Salivary secretion [PATH:mdo04970]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 148 aa AA seqDB search
MKVLILLGLVFLPMLAHGKVYERCELARVLKQNGMDGFGGNSLADWVCLAKWESDYNTKA
TNYNPGDQSTDYGIFQINSHYWCNDGKTPDAKNVCGISCRDLLTDNISKAITCAKRIVQD
FQGIRAWVAWRNHCEGRDVSSYIRGCGL
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtcctgattcttttgggtcttgtcttcctccccatgctagctcatggcaaggtc
tacgaaagatgtgaattggcaagagtcctgaagcaaaatgggatggatggcttcggaggt
aacagcctggccgactgggtgtgcttggcaaaatgggaaagtgattataacacaaaagcc
acaaattacaaccctggagatcaaagcaccgattatgggatatttcagatcaacagtcac
tattggtgcaatgatggcaagactcctgacgctaagaatgtgtgcggcatctcatgtaga
gatcttttaacagataatatcagcaaagctataacctgtgcaaagaggatcgtccaagat
ttccagggcattcgggcatgggtggcatggagaaaccattgcgaaggaagggatgtttcc
tcttatatccgaggttgcggtctttag

DBGET integrated database retrieval system