KEGG   Monodelphis domestica (opossum): 100013859Help
Entry
100013859         CDS       T01031                                 

Gene name
CACNA2D3
Definition
(RefSeq) calcium voltage-gated channel auxiliary subunit alpha2delta 3
  KO
K04860  
voltage-dependent calcium channel alpha-2/delta-3
Organism
mdo  Monodelphis domestica (opossum)
Pathway
MAPK signaling pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
Oxytocin signaling pathway
Hypertrophic cardiomyopathy (HCM)
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100013859 (CACNA2D3)
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    100013859 (CACNA2D3)
  Circulatory system
   04260 Cardiac muscle contraction
    100013859 (CACNA2D3)
   04261 Adrenergic signaling in cardiomyocytes
    100013859 (CACNA2D3)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    100013859 (CACNA2D3)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    100013859 (CACNA2D3)
   05414 Dilated cardiomyopathy (DCM)
    100013859 (CACNA2D3)
Ion channels [BR:mdo04040]
 Voltage-gated cation channels
  Ca2+ channel, CACN alpha-2 delta
   100013859 (CACNA2D3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
6
AA seq 1091 aa AA seqDB search
MLALPRLLRSCWGIFVLFWTAFLNITLVDVVGSEQQIPLSVVKLWASAFGGEMKSIAAKY
SGSQLLQKKYKEYEKDVAIEEIDGLQLVKKLAKNMEEMFHKKSEAVRRLVEAAEEAHLKH
EFDADLQYEYFNAVLINEQDEEGKYLELGKEFILVPNDHFNNLPVNISLSDVQVPTNMYN
KDPAIVNGVYWSESLNKVFVDNFDRDPSLIWQYFGSAKGFFRQYPGIKWEPDENGVIAFD
CRNRKWYIQAATSPKDVVILVDVSGSMKGLRLTIAKQTVSSILDTLGDDDFFNIIAYNEE
LHYVEPCLNGTLVQADRTNKEHFREHLDKLCAKGIGMLDIALNEAFSVLSEFNHTGQGSI
CSQAIMLITDGAVDTYDTIFAKYNWPERKVRIFTYLIGREAAFADNLKWMACANKGFFTQ
ISTLADVQENVMEYLHVLSRPKVIDQEHDVVWTEAYIDSTLPQAQKLADDQGLVLMTTVA
MPVFSKQNETRSKGILLGVVGTDVPVKELLKTIPKYKLGIHGYAFAITNNGYILTHPELR
PLYEEGKKRRKPNYSSVDLSEVEWEDRDDVLRNAMVNRKTGKFSMEVKKTVDKGKRVLVM
TNDYYYTDIKGTPFSLGVALSRGHGKYFFRGNVTIEEGLHDLEHPDVSLADEWSYCNTDL
QPEHRQLSQLDAIKLYLKGKEPLLQCDKELIQEVLFDAVVSAPIEAYWTSLALNKSENSD
KGVEVAFLGTRTGLSRINLFVGAEQLTNQDFLKAGDKENIFNADHFPLWYRRAAEQIPGS
FVYSIPFSVGAVNKSNVVTASTSIQLLDDRKSPVVAAVGIQMKLEFFQRKFWTASRQCAS
LDGRCSISCDDETINCYLIDNNGFILVAEDYMQTGNFFGEVEGAVMNKLLTMGSFKRITL
YDYQAMCRTNKESTDRAHSLLDPYNAFFAAVKWIMTELILFLVEFNLCSWWHSETTAKAQ
RLKQTLEPCDTEYPAFVSERTIKETTGNIACEDCSKSFVIQQIPSSNLFMVVVDNQCACD
SVSPITMAPIEIRYNESLKCERLKSQKIRRRPESCHGFHPEENARECGGALGLCAKPVLL
VIPLLLMLFSR
NT seq 3276 nt NT seq  +upstreamnt  +downstreamnt
atgctggcgctgccgaggctgctgcgctcttgctggggcatcttcgtgctcttctggacg
gcgtttctgaacatcacgctggtggatgtggtcggctcggagcagcagatccccctctca
gtggtgaagctctgggcctctgccttcggtggggagatgaaatccatcgcagccaagtat
tcaggttcccagcttctgcagaagaaatacaaagaatatgagaaggatgtggcaatagaa
gaaattgatggcctccagttggtgaaaaagctggcaaagaacatggaggagatgttccat
aagaagtcagaagcagtcaggcgtctcgtggaagctgcagaggaggctcacctgaaacac
gaatttgatgctgacttacagtatgaatatttcaatgcagtcctgattaatgagcaagat
gaggaaggaaaatatttggagctggggaaggaattcatcttggttccaaatgatcatttt
aacaacttgcctgtcaacattagcctgagtgatgttcaagttccaaccaacatgtacaac
aaggatcccgcaattgtcaatggcgtatactggtcggagtctttaaacaaagtgtttgta
gataattttgaccgggacccttctctcatttggcagtattttggaagtgcaaagggcttc
tttagacagtatccaggtattaaatgggaaccagatgagaatggagtcattgcttttgac
tgcagaaaccgaaaatggtatatccaagctgccacttctccaaaagatgtcgttatctta
gtggacgtgagtggcagcatgaaagggcttcgcttgaccattgccaagcaaacagtatct
tcgattttggataccctgggagacgatgacttcttcaacatcattgcttataatgaagaa
ctccactacgtcgaaccgtgcttgaatgggaccttagtccaggcagacaggacgaacaag
gagcatttcagagaacacctggacaagctttgtgccaaaggaattgggatgctggacatt
gctttgaacgaggccttcagtgtgctcagtgaattcaaccacaccggccagggaagcatc
tgtagccaggcaataatgctcattaccgatggggccgtagatacctacgatacaatcttt
gcaaagtataattggccagaaaggaaggtccgcatctttacatatctgataggaagagaa
gccgcatttgctgacaacctcaaatggatggcctgtgccaacaaaggctttttcactcag
atctccactttggctgatgttcaagagaatgtcatggagtatctacatgtgttgagccgg
ccaaaggttattgaccaggagcatgatgtggtctggactgaagcatacatcgacagcact
cttccccaggcacaaaagcttgctgatgatcaggggctggtcttgatgacgacagttgcc
atgcctgtgttcagcaagcaaaatgaaactagatcaaaagggattctgcttggagtggtt
ggcactgatgtcccagtgaaggagctcctgaagaccattcctaaatataagttggggatt
cacggttatgcttttgcgatcaccaacaatggctacatcctgactcatcctgaactcagg
cctttgtatgaagaaggaaaaaagcggaggaaacccaactatagcagtgttgacctttcg
gaagtggaatgggaagaccgggatgatgtgctcagaaatgccatggtgaatcggaagacg
gggaaattttccatggaggtcaagaagacagtggacaaagggaaacgggttttggtgatg
acaaatgactactattacactgacatcaagggcacgcctttcagtttaggtgtggctctc
tctagaggacatgggaaatatttcttcagagggaacgtaaccatagaagaaggcctgcac
gacttagaacatcctgacgtgtccttggcagatgaatggtcttattgcaacacagactta
cagcctgaacaccgacagctgtcccaattggatgctattaagctctacctcaaaggaaaa
gagccacttcttcagtgtgacaaagaattaatccaggaagttctctttgatgctgtagtg
agtgcccccatcgaagcttactggaccagcctcgcgctcaacaaatcagagaactccgac
aagggcgtcgaggtcgccttcctcggcacccggaccggcctctccaggatcaacctgttt
gtgggtgccgagcagctcaccaaccaagacttcctgaaagctggagataaggagaatatt
ttcaatgctgatcactttccactctggtacagaagagcagctgagcagattccaggcagc
tttgtctactccatcccattcagcgtcggagccgtaaataaaagcaatgtggtgactgcg
agtacttccatccaactcctcgatgacaggaaatcaccagtggtagcagctgtaggcatt
cagatgaaactcgaatttttccagcggaagttctggactgccagcagacagtgcgcctct
ctggatggcaggtgctccattagctgtgatgatgaaaccattaattgttacctgatcgat
aataacggcttcatcctggtggctgaagactacatgcagactggaaacttttttggtgag
gtcgagggagctgtgatgaacaaattgttaacaatgggctcctttaagaggattacactt
tacgactaccaggctatgtgcagaaccaacaaagagagcactgaccgggctcacagttta
ttagatccttataatgccttctttgcggctgttaaatggataatgacggaactgatcttg
tttctggtggaatttaacttgtgcagttggtggcactcagaaaccacagccaaagcccaa
aggttgaaacaaactctggaaccctgtgacacagaatatccagccttcgtctcggagcgt
accatcaaggagacgacgggcaacattgcatgcgaagactgctccaagtcctttgtcatc
cagcagatcccaagcagcaatctgttcatggtggtggtcgataaccaatgtgcctgtgat
tcggtgtcacccattaccatggctccaattgaaatcaggtataatgaatcccttaagtgt
gaacgcttgaaatcccagaaaatcagaaggcggccagaatcctgtcatggctttcatcct
gaagagaatgcaagagaatgtgggggagccctgggtctctgtgccaagcctgtcctcctt
gtgatccctctgcttctgatgcttttctcaaggtga

DBGET integrated database retrieval system