KEGG   Monodelphis domestica (opossum): 100013861Help
Entry
100013861         CDS       T01031                                 

Gene name
USP13
Definition
ubiquitin specific peptidase 13 (isopeptidase T-3)
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.4.19.12]
Organism
mdo  Monodelphis domestica (opossum)
Brite
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100013861 (USP13)
Peptidases [BR:mdo01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100013861 (USP13)
Exosome [BR:mdo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100013861 (USP13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
7
AA seq 876 aa AA seqDB search
MQRAALFGSPGGGPGGGSGPGPGPGPGKMAAGDLGELLVPYMPTIRVPRSGDRVYKAECA
FSYDSPISEGGLYVCMNTFLAFGREHVERHYRKTGQCVYMHLKRHVREKVTGASGGVLPK
RRNTKLFLDLEMTGDLNSDDYEYEDEAKLVIFPDHYEIALPNIEELPALVTIACDAVLNS
KSPYRKQEPDSWENELQVSKHANNLMQLDNGVRIPPSGWKCAKCDLRENLWLNLTDGTIL
CGKWFFDNMGGNGHALDHYKEMGYPLAVKLGTITPDGADVYSFQEEESVLDPHLAKHLAH
FGIDMLQMHSTENGTRDNDVKPRISEWEVIQESGMKLKPMYGSGYTGMKNLGNSCYLSAV
MQAIFSIPEFQRMYVGNLARIFDYSPLDPTQDFNTQMAKLGHGLLSGQYSKPPMKSELIE
QVMKEEHKPQQNGISPCMFKAFVSKSHPEFSSNRQQDAQEFFLHLVNLVERNRIGSENPS
DVFRFVVEERIQCCQSRKVRYTERVDYLMQLPVAMEAATNKDELIAYELTRREAETSRRP
LPELVRARIPFSACLQAFSEPDNVEDFWSSALQAKSAGVKTSRFASFPEYLVVQIKKFTF
GLDWVPKKFDVSIDMPDLLDINHLRATGLQPGEEELPDIAPPIVIPDDPKDRLMNHYMEP
PDIDESSVMQLAEMGFPLEACRKAVYYTGNMGPEVAFNWIIGHMEEPDFAEPLSLPGFGG
SAALGATAFGAIGLDNQPPEEIVAIITSMGFQRNQAIQALKATNNNLERALDWIFSHPEL
EEDNEFAAHMMEMENNANANIISESKPDGPRVKDGSGRYELFGFISHMGPSTMSGHYVCH
IKKEGRWVIYNDHKVCASERPPKDLGYMYFYHRISS
NT seq 2631 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgggccgccctattcggcagccctggcggcggccccggcggcggcagcggcccc
ggtccgggtcctggccccgggaagatggctgcaggagacctcggggagctgctggtccct
tacatgcccaccatccgcgtccccaggtccggggatcgtgtctacaaggcggagtgcgcc
ttctcttacgactccccgatttcagaaggaggtctctatgtgtgcatgaatacgttcctg
gcctttggaagggaacatgttgaaaggcactatcggaaaactggacagtgtgtgtacatg
catctgaaaagacacgtgagagagaaagtaacaggggcatctggtggcgtgttaccaaaa
aggaggaataccaagctattcttagatctagaaatgactggagatttaaatagtgatgac
tatgaatatgaagatgaagccaagcttgttatatttccagaccactatgaaattgcattg
ccaaatattgaggagttacctgcactggtaacaattgcgtgtgatgctgtccttaactca
aaatctccgtataggaaacaggagccggattcctgggaaaatgaactgcaagtttccaaa
catgccaataacctcatgcaactggacaatggtgtcaggattcctcccagtggctggaag
tgtgccaagtgtgacttgcgggagaacctctggttaaatctgactgatggtaccatcctt
tgtggaaagtggttctttgacaacatggggggaaacgggcatgcgttggaccactacaaa
gaaatgggctaccccttagcagtgaagttaggaaccattacaccagatggggcagatgtt
tattccttccaagaagaggaatctgttctagacccacatttagccaagcatttagcacat
tttggaatcgacatgcttcagatgcattcgacggagaatggcacgagggacaatgatgtc
aaacccaggatcagtgaatgggaagtcattcaggagtcgggaatgaaactgaagcccatg
tatggttctggatacactgggatgaagaacctgggaaacagctgctatctcagtgcggtc
atgcaagccatcttcagcatccccgagtttcagagaatgtatgtgggaaacttggcaaga
atatttgactactctcctctagacccaacacaggatttcaacacacagatggctaagtta
ggacatggccttctctcaggccaatattctaaacctcccatgaaatctgagctcattgaa
caggtgatgaaagaagaacataagcctcagcagaatgggatctctccatgcatgttcaag
gcctttgtcagcaagagccaccctgaattctcctccaacagacagcaggatgcccaggag
tttttcttgcacctggtaaatctagtggagaggaaccgaattggctctgaaaatccaagt
gatgttttccggtttgtggtagaagaacgaattcagtgctgtcagtccaggaaagttcgc
tacacggagagggtcgattatttgatgcagttgccggtggccatggaagcggcaacgaac
aaggatgagctgattgcctatgagttgaccagaagagaagcggagacatccaggagaccg
ctcccagaattggtccgggccaggattcctttcagtgcctgccttcaggccttttctgaa
ccagacaatgtggaagacttctggagcagcgccctacaggcaaagtctgctggtgtgaaa
acatctcgctttgcttcattccctgagtacttggtagtgcagataaagaagttcactttt
ggtcttgactgggttccgaaaaagttcgatgtctccattgatatgccagacctccttgat
atcaaccatctcagagccacagggttacagcccggagaggaagagcttccagatattgcc
cctccaatagtcattcctgatgaccccaaagatcgattgatgaaccattatatggaacca
ccagacattgacgagtcctctgtgatgcagctggcagagatgggtttccctttggaggca
tgtcggaaggcagtgtactacactggaaacatgggacctgaggtggccttcaactggatc
attggccatatggaagagcctgattttgccgagccgctttccctgcctggttttggagga
agtgctgctttgggggccactgcttttggtgctattggattggataaccagcctccagaa
gaaattgtagccatcattacctccatgggtttccagaggaatcaggccattcaggcatta
aaggcaacgaataacaatttggagcgggccctggactggatttttagccatcctgaactg
gaagaagataacgagtttgctgcccacatgatggagatggagaacaacgccaatgctaac
attatttcagagtccaaaccagatggtcccagagtgaaagatggatcaggaaggtatgag
ctatttgggttcatcagccacatgggaccgtccaccatgagtggccattatgtttgtcat
atcaaaaaggaaggcagatgggtgatctacaatgaccataaagtatgtgcctcagaaagg
ccccccaaagacctgggctacatgtacttttaccataggatatcaagctag

DBGET integrated database retrieval system