KEGG   Monodelphis domestica (opossum): 100013959Help
Entry
100013959         CDS       T01031                                 

Definition
(RefSeq) histone H2B type 1-F/J/L
  KO
K11252  
histone H2B
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100013959
  Immune diseases
   05322 Systemic lupus erythematosus
    100013959
  Substance dependence
   05034 Alcoholism
    100013959
Chromosome [BR:mdo03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    100013959
Exosome [BR:mdo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100013959
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
2
AA seq 126 aa AA seqDB search
MPEPGKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaaccaggaaaatcggctccggcccccaaaaagggatccaagaaagccgtgacc
aaggctcagaagaaagatggcaagaagcgcaagcgcagccgcaaggagagctattccgtc
tacgtctacaaagtgctgaagcaagtccaccctgataccggcatctcctccaaggcaatg
ggcatcatgaactccttcgtcaacgacatcttcgagcgtatcgccagcgaggcttctcgc
ctggcccactacaacaagcgctcgaccatcacatcccgggagatccagacggctgtgcgc
ctgctgctgcccggggaactggccaagcacgccgtgtcggagggcactaaggccgtcacc
aagtacaccagctccaagtaa

DBGET integrated database retrieval system