KEGG   Monodelphis domestica (opossum): 100014031Help
Entry
100014031         CDS       T01031                                 

Gene name
CYLD
Definition
cylindromatosis (turban tumor syndrome)
Orthology
K08601  
ubiquitin thioesterase CYLD [EC:3.1.2.15]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Osteoclast differentiation
RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Organismal Systems
  Immune system
   04622 RIG-I-like receptor signaling pathway
    100014031 (CYLD)
  Development
   04380 Osteoclast differentiation
    100014031 (CYLD)
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100014031 (CYLD)
Peptidases [BR:mdo01002]
 Cysteine Peptidases
  Family C67
   100014031 (CYLD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 956 aa AA seqDB search
MNSGLWSQEKVTSPYLEERIFYLLLQECSVSDKQTQKIIKVPKGSIGQYVQDRSLSHARI
PLSKGKKNHIGLKILEQPHAVLFVDEKDVVEISEKFTELLLAITNCEERFSLFKNRSRLS
KGLQIDVGCPVKVQLRSGEEKFPGVVRFRGPLLTERTVSGIFFGVELLEEGRGQGFTDGI
YQGKQLFRCDEDCGVFVALDKLELIEDDDSTLESDYAGPIDMMQVELPPLEINSRVSLKV
GEGIESGTVIFCDVLPGKENLGYFVGVDMDNPIGNWDGRFNGIQLCSFASVESTLLLHIN
DIIPALSDSVTQERRPPKLAFMPRGGGDKALSSHSKPKATGSTSDPGNRSRSELFYTLNG
GSVDSQPQIKSKNTWYSDEVAEDPAKSLTDISSDFGHSSPPLQPPSINSSANENRFHSLP
FSLTKMPNTNGGIGHSPLSLSVQSVIGELNNSPVQESPPLTVPSSNSHGLEVGSLAEVKD
NPPFFGVIRWIGQPPGLNEVLAGLELEDECAGCTDGTFRGTRYFTCALKKALFVKLKCCR
PDSRFASLQPVSNQIERCNSLAFGGYLSEVVEENTPPKMEKEGLEVMIGKKKGIQGHYNS
CYLDSTLFCLFSFSSVLDTVLLRPKEKNDVEYYSETQELLRTEIVNPLRIYGYVCATKIM
KLRKILEKVEAASGFTSEEKDPEEFLNILFHHILRVEPLLKIRSAGQKVQDCYFYQIFME
KNEKVGVPTIQQLLEWSFINSNLKFAEAPSCLIIQMPRFGKDFKLFKKIFPSLELNITDL
LEDTPRQCRICGGLAMYECRECYDDSDISAGKIKQFCKTCNTQVHLHPKRLSHKYNPVSL
PKDLPDWDWRHGCIPCQKMELFAVLCIETSHYVAFVKYGRDDSAWLFFDSMADRDGGQNG
FNIPQVTPCPEVGEYLKMSVEELHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLYK
NT seq 2871 nt NT seq  +upstreamnt  +downstreamnt
atgaattcaggcttatggagccaagaaaaagttacttcaccttacttggaagaacgaatt
ttttacttgcttctgcaagaatgcagtgtttcagacaaacaaacacaaaagattattaaa
gtacctaaaggaagcataggacaatatgttcaagatcgttctttgagccatgcaagaatt
cctctttctaaaggcaagaaaaatcatattggattaaaaattttggaacagccacatgca
gtcttatttgtggatgagaaggatgttgtagaaataagtgaaaaattcacagaattgctt
ttggccattaccaattgtgaggaaagattcagtctgtttaaaaacagaagcagactaagt
aaaggcctccaaatagatgtgggatgccctgtgaaagtacagctgagatctggggaagaa
aaatttcctggagttgtacgcttcagaggacctttgttaacggagaggacagtgtcggga
atattctttggcgtagaattgctggaagaaggtcggggtcaaggtttcactgatggaatt
taccaagggaaacaacttttccggtgtgatgaagattgtggtgtctttgtggctttggac
aaattagagcttatagaagatgatgacagtacattggaaagtgattatgcaggcccgatt
gacatgatgcaggttgaacttcctcctttggaaataaattccagagtttctttgaaggtt
ggcgaaggtatagaatctggaacagttatattctgtgatgtcttgccaggaaaagagaat
ttaggatactttgttggagttgatatggataatcctattggaaattgggatggaagattc
aatggaatacaactttgtagttttgcaagtgtggaaagtacacttttgttgcatatcaat
gatattataccagctttatcagatagtgtgacacaagaaagaaggcctcccaaacttgca
tttatgccaagaggtggtggggataaagctttatccagtcatagtaaaccaaaggctaca
ggatctacctcagaccctggaaatagaagcagatctgaattattttacacgttaaatggt
ggttctgttgattctcaaccacaaatcaaatcaaaaaacacttggtacagtgatgaagtt
gctgaagatcctgcaaaatccctaacagatatatcatcagattttggacattcttcacca
cctctgcagcctccttctataaactcttccgccaatgagaacagatttcactctttacca
tttagcttgacaaagatgccaaataccaatggaggtattgggcatagtcctctatctctc
tctgttcagtcggtgataggagagctaaacaactctccggtccaggagagtccacctttg
actgtaccttcaagtaattcacatggtcttgaagtaggctcattggctgaagttaaagat
aatcctcctttctttggtgtaatacgttggattggtcagccaccaggactaaatgaagta
ttagcaggactggaactggaagacgaatgtgcaggctgtacagatggaactttcagaggt
acgcgttatttcacctgtgccctaaagaaggcgctgttcgttaaactcaagtgctgcagg
cctgattctaggttcgcctcacttcagccagtttccaaccagattgaacggtgcaactct
ttagcatttggaggttacttaagtgaagtggtagaagagaatactccaccaaaaatggaa
aaagaaggtttagaggtaatgattggaaagaagaaaggtatccagggccattacaattct
tgttacttagactctaccttattctgcttattttcttttagttctgttctggacactgtc
ttacttagacctaaagaaaagaatgatgtagaatattatagtgaaactcaagaactactg
aggacagaaattgtaaatcctcttagaatatatggatatgtttgtgccacaaaaattatg
aaactgagaaaaatacttgagaaagttgaggctgcatcaggttttacctctgaagaaaaa
gatcctgaagagttcttgaacatcctgtttcatcatatcttgagggtagaaccattatta
aagataagatctgcaggacaaaaggtacaagattgttatttctatcaaatttttatggaa
aaaaatgaaaaagttggtgttcctacaattcaacagctgctagaatggtctttcatcaat
agtaacctaaaattcgcagaggcaccatcatgtctgattattcagatgcctcgatttgga
aaagacttcaaactcttcaaaaaaatttttccttcactggaattaaatataacagattta
cttgaagatactcccagacagtgccggatatgtggaggacttgctatgtatgaatgcaga
gaatgctatgatgattctgacatttctgctgggaaaatcaagcagttttgtaaaacctgc
aacacacaagtccaccttcatcccaagaggttaagtcataaatacaatccagtgtcactt
cccaaagacttgcctgactgggactggagacatggctgtataccttgtcagaagatggag
ttgtttgctgttctctgcattgaaacaagccattatgttgcttttgtaaagtatgggcga
gatgactcagcctggctcttctttgacagcatggctgaccgtgatggtggtcagaatggc
tttaacattcctcaagttaccccatgcccagaagtcggggagtacttgaaaatgtcagta
gaagaactgcattccctggactccaggagaatccaaggctgtgctagaagacttctttgt
gatgcatatatgtgcatgtatcaaagtccaacaatgagtttgtacaagtaa

DBGET integrated database retrieval system