KEGG   Monodelphis domestica (opossum): 100014049Help
Entry
100014049         CDS       T01031                                 

Gene name
CREB1
Definition
(RefSeq) cAMP responsive element binding protein 1
  KO
K05870  cyclic AMP-responsive element-binding protein 1
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo04022  cGMP-PKG signaling pathway
mdo04024  cAMP signaling pathway
mdo04151  PI3K-Akt signaling pathway
mdo04152  AMPK signaling pathway
mdo04211  Longevity regulating pathway
mdo04261  Adrenergic signaling in cardiomyocytes
mdo04380  Osteoclast differentiation
mdo04612  Antigen processing and presentation
mdo04668  TNF signaling pathway
mdo04710  Circadian rhythm
mdo04713  Circadian entrainment
mdo04714  Thermogenesis
mdo04725  Cholinergic synapse
mdo04728  Dopaminergic synapse
mdo04911  Insulin secretion
mdo04915  Estrogen signaling pathway
mdo04916  Melanogenesis
mdo04918  Thyroid hormone synthesis
mdo04922  Glucagon signaling pathway
mdo04924  Renin secretion
mdo04925  Aldosterone synthesis and secretion
mdo04926  Relaxin signaling pathway
mdo04927  Cortisol synthesis and secretion
mdo04928  Parathyroid hormone synthesis, secretion and action
mdo04931  Insulin resistance
mdo04934  Cushing's syndrome
mdo04962  Vasopressin-regulated water reabsorption
mdo05016  Huntington's disease
mdo05030  Cocaine addiction
mdo05031  Amphetamine addiction
mdo05034  Alcoholism
mdo05152  Tuberculosis
mdo05161  Hepatitis B
mdo05165  Human papillomavirus infection
mdo05166  HTLV-I infection
mdo05167  Kaposi's sarcoma-associated herpesvirus infection
mdo05203  Viral carcinogenesis
mdo05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Environmental Information Processing
  Signal transduction
   04668 TNF signaling pathway
    100014049 (CREB1)
   04024 cAMP signaling pathway
    100014049 (CREB1)
   04022 cGMP - PKG signaling pathway
    100014049 (CREB1)
   04151 PI3K-Akt signaling pathway
    100014049 (CREB1)
   04152 AMPK signaling pathway
    100014049 (CREB1)
 Organismal Systems
  Immune system
   04612 Antigen processing and presentation
    100014049 (CREB1)
  Endocrine system
   04911 Insulin secretion
    100014049 (CREB1)
   04922 Glucagon signaling pathway
    100014049 (CREB1)
   04915 Estrogen signaling pathway
    100014049 (CREB1)
   04926 Relaxin signaling pathway
    100014049 (CREB1)
   04918 Thyroid hormone synthesis
    100014049 (CREB1)
   04928 Parathyroid hormone synthesis, secretion and action
    100014049 (CREB1)
   04916 Melanogenesis
    100014049 (CREB1)
   04924 Renin secretion
    100014049 (CREB1)
   04925 Aldosterone synthesis and secretion
    100014049 (CREB1)
   04927 Cortisol synthesis and secretion
    100014049 (CREB1)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100014049 (CREB1)
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    100014049 (CREB1)
  Nervous system
   04725 Cholinergic synapse
    100014049 (CREB1)
   04728 Dopaminergic synapse
    100014049 (CREB1)
  Development
   04380 Osteoclast differentiation
    100014049 (CREB1)
  Aging
   04211 Longevity regulating pathway - mammal
    100014049 (CREB1)
  Environmental adaptation
   04710 Circadian rhythm
    100014049 (CREB1)
   04713 Circadian entrainment
    100014049 (CREB1)
   04714 Thermogenesis
    100014049 (CREB1)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100014049 (CREB1)
   05215 Prostate cancer
    100014049 (CREB1)
  Neurodegenerative diseases
   05016 Huntington's disease
    100014049 (CREB1)
  Substance dependence
   05030 Cocaine addiction
    100014049 (CREB1)
   05031 Amphetamine addiction
    100014049 (CREB1)
   05034 Alcoholism
    100014049 (CREB1)
  Endocrine and metabolic diseases
   04931 Insulin resistance
    100014049 (CREB1)
   04934 Cushing's syndrome
    100014049 (CREB1)
  Infectious diseases
   05152 Tuberculosis
    100014049 (CREB1)
   05166 HTLV-I infection
    100014049 (CREB1)
   05161 Hepatitis B
    100014049 (CREB1)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100014049 (CREB1)
   05165 Human papillomavirus infection
    100014049 (CREB1)
Transcription factors [BR:mdo03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   CREB
    100014049 (CREB1)
Mitochondrial biogenesis [BR:mdo03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    100014049 (CREB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: pKID bZIP_1 bZIP_2 bZIP_Maf ASD2 HNF-1A_C DUF4988
Motif
Other DBs
NCBI-GeneID: 100014049
NCBI-ProteinID: XP_007501910
Ensembl: ENSMODG00000015970
Position
7
AA seq 327 aa AA seqDB search
MTMESGAETQQSGDAAVTEAENQQMAVQTQPQIATLAQVSMPAAHATSSAPTVTLVQLPN
GQTVQVHGVIQAAQPSVIQSPQVQTVQISTIAESEDSQESVDSVTDSQKRREILSRRPSY
RKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSGQYIAITQGGAIQLA
NNGTDGVQGLQTLTMTNAAATQASTTILQYAQTTDGQQILVPSNQVVVQAASGDVQTYQI
RTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAARECRRKKKEYVKCLENR
VAVLENQNKTLIEELKALKDLYCHKSD
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaccatggaatctggtgcagagacccaacagagtggcgatgcagctgtaacggaagca
gaaaatcaacagatggctgtacaaacacaaccacagattgcaacattagcacaggtttct
atgccagcagctcatgcaacttcatctgctcccacagtgaccttagtgcagctccctaat
gggcagacagttcaagtccatggagttattcaggcagcccagccatcagttattcaatct
ccacaagtccagacagttcagatttctactattgcagagagtgaagattcacaggaatca
gtagatagtgtcacagattctcaaaaaagaagagaaattctttcaagaaggccctcctac
aggaaaattttgaatgacttatcctcagatgcacctggagttccaagaattgaagaagaa
aagtctgaagaggagacatcagcacccgccattacaactgtgacggtgccaactccaatc
taccagactagtagtggacaatacattgctattacccagggaggagcaatacagttggct
aataatggcacggacggagtacagggcctacaaacgttaactatgacaaatgcagctgcc
actcaggccagcactaccatcctgcagtatgcacaaaccactgatgggcaacagattctc
gtacctagcaatcaagttgttgtgcaagctgcctctggagatgtacaaacataccagatt
cgaacagcacccaccagtaccattgcacctggtgttgttatggcatcatccccagcactt
cccacccaacctgcagaagaggctgcacgaaaaagggaagttcgtctaatgaagaatagg
gaagcagcacgtgagtgtcgtaggaagaaaaaggaatatgtgaaatgtctagagaacaga
gtggctgtgcttgagaaccaaaacaagacactgattgaggagctgaaagcacttaaggac
ctttactgccacaaatcggattaa

DBGET integrated database retrieval system