KEGG   Monodelphis domestica (opossum): 100014099Help
Entry
100014099         CDS       T01031                                 

Gene name
RASGRF1
Definition
(RefSeq) Ras protein specific guanine nucleotide releasing factor 1
  KO
K04349  Ras-specific guanine nucleotide-releasing factor 1
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo04010  MAPK signaling pathway
mdo04014  Ras signaling pathway
mdo04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100014099 (RASGRF1)
   04010 MAPK signaling pathway
    100014099 (RASGRF1)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    100014099 (RASGRF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RasGEF RhoGEF PH RasGEF_N GOLGA2L5 PH_11 PH_13 IQ Mg_chelatase Sec34
Motif
Other DBs
NCBI-GeneID: 100014099
NCBI-ProteinID: XP_001368432
Ensembl: ENSMODG00000019438
Position
1
AA seq 1256 aa AA seqDB search
MQKGIRLNDGHVTYLGLLAKKDGTRRGYLSKRSSDNTKWQTKWFALLQNLLFYFENDSSS
RPSGLYLLEGCVCDRAPSPKPSLSGKESLEKQHYFTVNFNHENQKTLELRTEDAKDCDEW
VAAITHASYRNLATEHEALMQKYLHLLQIVETEKTVAKQLRQQIEDGEIEIERLKSEIAS
LLKDNDRIQSVQTVTPNDEDSDIKKIKKVQSFLRGWLCRRKWKTIIQDYIRSPHADSMRK
RNQVVFSMLEAEAEYVQQLHILVNNFLRPLRMAASSKKPPITHDDVSSIFLNSETIMFLH
QIFYQGLKARISSWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQILAHCKQNRDFDKLL
KHYEAKPDCEERTLETFLTYPMFQIPRYILTLHELLAHTPHEHVERNSLDYAKSKLEELS
RIMHDEVSETENIRKNLAIERMIIEGCEILLDTSQTFVRQGSLIQVPMSEKGKITRGRLG
SLSLKKEGERQCFLFSKHLIICTRGSGGKLHLTKNGVISLIDCTLMEEQESTDEENKSSG
QDIDHLDFKIVVEPKDCPSFTVILVASSRQEKAAWTSDISQCVDNIRCNGLMMNAFEENS
KVTVPQMIKSDASLYCDDVDIRFSKTMNSCKVLQIRYASVGRLLERLTDLRFLSIDFLNT
FLHSYRVFTTAVVVLDKLITIYKKPISAIPARSLELLFASGQNNKLLYGEPPKSPRANRK
FSSPPPLSITKSSSPSRRRKLSLNIPIITGGKALDLAALSCSSNGYASMYSSMSPFSKTT
LDISKLYVSSNFPNKIPDEGESTAEKIEDSNLNKQSSEVSVREESDNDQNQSDDADTETS
PTKSPTTPKSIKNKNASEFSLFSYNNGVVMTSCRELDNNRSALSAASAFAIATAGANEGT
PNKEKYRRMSLASAGFPPDQRNGDKEFVIRRAATNRVLNVLRHWVSKHSQDFETNDELKF
KVISFLEEVIHDPELLTQERKAAANIIRTLTQEDPGDNQITLEEIVQMAEGVKAEPFENH
SALEIAEQLTLLDHLVFKKIPYEEFFGQGWMKVEKNERTPYIMKTTKHFNDISNLIASEI
LRSEDVNARVSAIEKWVAVADICRCLHNYNAVLEITSSMNRSAIFRLKKTWLKVSKQTKA
LIDKLQKLVSSEGRFKNLREALKNCDPPCVPYLGMYLTDLAFIEEGTPNYTEDGLVNFSK
MRMISHIIREIRQFQQTAYKIEHQAKVTQYLLDQSFVMDEESLYESSLRIEPKLPT
NT seq 3771 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaaggaatacggttgaatgatggccatgtaacctacctggggctgttggcaaag
aaagatggcacgagacgaggttatctgagcaagagaagctcagataacacaaaatggcaa
acgaagtggttcgctttgctgcaaaacctgctcttctactttgaaaatgactccagttcc
agaccctctggattgtacctgttggagggctgcgtgtgtgaccgggcgccgtctccgaag
ccgtccctctcaggaaaggaatcgctggagaaacagcattatttcacggttaacttcaac
catgagaatcagaaaaccctagagttgagaacagaagatgctaaagactgtgatgaatgg
gtagctgcaataactcatgcaagttacaggaacctggccacagagcatgaagctttaatg
cagaagtacctccacttacttcaaattgtggaaacagaaaaaacagttgctaaacagctg
cgacaacagatcgaagatggggagattgagattgaacggctgaaatcagagattgcttcc
ttgctcaaggacaatgatcgaattcagtcagtccagactgtcacacccaatgatgaagac
agtgacatcaagaaaattaagaaggtgcaaagctttttgcgaggctggctctgccggaga
aaatggaagacaattattcaggactatatccggtcacctcatgctgacagcatgcggaaa
agaaaccaagtggtatttagcatgcttgaggcagaagcagaatatgtccagcaactgcac
atcttagtcaataacttcctccgtcccttgaggatggctgccagctcaaaaaagcctcct
attacacacgatgatgtcagcagcatcttcctaaatagtgaaacaatcatgtttttgcat
cagattttttaccaaggcctcaaagcccggatatccagctggccaacattagtgcttgct
gacctatttgacatactgctgcctatgctgaatatctaccaggagtttgtgagaaaccat
caatacagcttgcagatcctagctcactgcaaacagaacagggattttgacaaactcctc
aagcattatgaggcaaagccagactgtgaagagagaactctggagacctttctcacttat
cctatgtttcagatccctaggtatattctgacattacatgagcttctggcacacactcct
catgaacatgtagaacgcaacagtttggattatgcaaaatcaaaactagaggaattatcc
agaataatgcacgatgaagtgagtgaaactgagaacattcggaaaaacctggcaattgaa
agaatgatcatagaagggtgtgaaattctcctggataccagccaaacttttgtaagacaa
ggttccctcatccaggtgcctatgtctgaaaaaggaaaaattacaagaggacgcctgggg
tccctgtctttaaagaaagagggagagagacaatgttttctcttttctaagcatttaatt
atctgtaccagaggctctggtggaaagctacacttaacgaagaatggagtaatctcactc
attgactgcaccttgatggaagagcaagaaagcacagatgaggaaaataaatcctctgga
caagatatagaccacttggattttaagattgtggtggagccaaaagactgtccttctttc
actgtcatcctcgtggcatcctccagacaagagaaagctgcttggacaagtgacattagt
cagtgtgtagataatattagatgcaatggcctcatgatgaatgcctttgaagaaaactcc
aaagtcaccgttcctcaaatgatcaagtcagatgcctccctatattgtgacgatgttgac
atccgattcagcaaaaccatgaactcttgtaaggtcctgcagattcgttatgccagtgta
gggcgacttctggagaggctcacagaccttcggttcctgagcatagatttcctcaacaca
ttcttgcattcttaccgtgtgttcacaacagctgtggtggttctggacaagctcatcact
atttacaagaaacctattagtgcaatacctgcaaggtcactggagctcttgtttgccagc
ggccaaaacaacaagcttctgtatggtgaacctcctaagtccccaagagctaatcgcaag
ttctcctccccaccacctctatccattaccaagtcatcttcaccaagtagaagaagaaag
ctttccttaaacatccccatcatcactggaggaaaggctttggatctggctgctttaagc
tgttcttcaaatggctatgcaagcatgtattcttctatgtcaccctttagtaagaccacg
ctggacatcagtaaattatatgtatccagtaactttcctaataagatacctgatgagggt
gaaagtacagctgaaaaaatagaagactcaaatctcaacaaacaaagttcagaagtctca
gtaagagaagagtccgataatgatcaaaaccagagtgatgatgcagacacagagacttcg
cccactaagtccccaactaccccaaaatcaatcaaaaacaagaatgcttcagaattttct
ctcttctcttataacaatggagttgttatgacttcgtgtcgagaactggacaataaccgg
agtgccctctcggctgcctcggcttttgccatagccactgcgggcgccaatgagggcaca
ccaaacaaggagaagtaccgaaggatgtcattagcaagtgcaggttttccccctgaccaa
agaaatggggacaaagaatttgtgataaggagagctgcaaccaaccgagtattgaatgtc
cttcgacattgggtctcaaagcattcacaggattttgaaaccaacgatgaactaaaattt
aaagttattagttttctggaagaagtcattcatgaccctgaacttttgacccaagaaaga
aaagcagctgccaatatcataaggactttgacgcaggaagatccaggagacaaccagatc
acactggaggagatcgtacaaatggctgagggagtgaaagcagagccctttgaaaaccat
tctgctttggaaatagctgaacagctgacgctactggaccacctggtctttaagaagatt
ccatatgaagagttttttggacaaggctggatgaaagttgaaaagaatgaaagaactcct
tacattatgaaaaccaccaaacatttcaatgatatcagtaacctgatagcttcagaaatc
ctccgaagtgaggatgtcaatgcccgagtcagtgccattgaaaagtgggtggctgtggct
gacatctgccgatgcctacacaattacaatgctgtgctagaaatcacctcttccatgaac
cgcagtgcaatattcagactgaagaaaacatggctgaaagtctccaaacagacaaaagct
ttgattgataaactccaaaaacttgtgtcatcagagggcagatttaagaatctgagagaa
gctctgaaaaattgtgacccaccttgtgttccatatcttggaatgtacctcactgatctg
gcattcatagaagaaggaacacccaattatacagaggatggcctggtaaacttctccaaa
atgaggatgatatcccatattatcagagagatccgtcaatttcagcaaacggcctacaaa
atagaacaccaggcaaaggtaacacaatatttactggaccaatcttttgtaatggatgaa
gaaagcctttatgaatcctctctacgaatagaacccaaattgccaacctga

DBGET integrated database retrieval system