KEGG   Monodelphis domestica (opossum): 100014156Help
Entry
100014156         CDS       T01031                                 

Gene name
FLNB
Definition
filamin B, beta
Orthology
K04437  
filamin
Organism
mdo  Monodelphis domestica (opossum)
Pathway
MAPK signaling pathway
Focal adhesion
Salmonella infection
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100014156 (FLNB)
 Cellular Processes
  Cell communication
   04510 Focal adhesion
    100014156 (FLNB)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    100014156 (FLNB)
  Infectious diseases
   05132 Salmonella infection
    100014156 (FLNB)
Exosome [BR:mdo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100014156 (FLNB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
6
AA seq 2608 aa AA seqDB search
MPVTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKRIGNLQTDLSDGLRLIALLEVLSQK
RMYRKYHQRPTFRQMQLENVSVALEFLELESIKLVSIDSKAIVDGNLKLILGLVWTLILH
YSISMPVWEDEGDDDAKKQTPKQRLLGWIQNKIPYLPITNFNQNWQDGKALGALVDSCAP
GLCPDWESWDPSKPVDNAREAMQQADDWLGVPQVITPEEIIHPNVDEHSVMTYLSQFPKA
KLKPGAPLKPKLNPKKARAYGRGIEPNGNMVKQPARFTVDTISAGQGDVMVIVEDPEGNK
EEAQVTPDGDKNKTYSVEYLPKVTGLHKVTVLFAGQHISKSPFEVNVDKAQGDASKVTAK
GPGLEASGNIANKATFFDIYTAGAGVGDIEVEVEDPQGKKTVEMAMEDKGNQVYRCAYKP
VQSGPHVVKVSFAGESIPKSPFMVNVGEACNPNACRASGRGLQPKGVRIRETADFKVDTK
SAGSGELSVTVRGPKGLEELVKQKGFMNGVYAFEYYPGTPGKYVVVITWGGHNIPKSPFE
VQVGPEADVQKVRAWGPGLHGGIVGRSADFVVESIGSEVGSLGFAIEGPSQAKIEYNDQN
DGSCDVKYWPKEPGEYAVHIMCDDEDIKDSPYMAYIQPASGDFNPDLVQAYGPGLEKTGC
IVNNLAEFTVDPKDAGKAPLKIYAQDGEGNPIDIQMKSKMDGTYSCFYTPLKPIKHTIAV
VWGGVNISQSPYRVGVGQGSHPQRVKVFGPGVERSGLKANEPTHFTVDCTEAGEGDVSVG
IKCDAGVLGIDEEDVDFDIIHNANDTFTVKYAPPAPGRYTIKVLFASKEIPASPFRVKVD
PSHDASKVRAEGPGLSKAGVENGKPTHFTVFTKGAGKAPLDVQFTGPQAGVAVRDLDIID
NYDYSHTVKYTPVQQGSTQVLVTYGGDPIPKSPFVVEVAAPLDLSKIKLNGLENRVEVGK
DQEFVVDTKGAGGQGKLDVTILSPTRQVVPCLVAPVAGKDYSTVKYIPKEEGLYAVDVSY
DGNPIPGSPFTVEASLPPDPTKVKAHGPGLEGGYVGNPAEFTIDTKGAGTGGLGLTVEGP
CEAKIECSDNGDGTCSVSYLPTKPGEYFVNILFEEVHIPGSPFKADIEMPFDPSKVVASG
PGLERGKVGEAGILKVDCSEAGYGVLGMEAVSDAGVKADVHIQNNKDGTYAVTYVPLAAG
MYTLTLNYGGEQVPAFPARVKVEPAIDTSKIKVYGPGIEGKDVFREATTNFTVDSRPLTK
VGGDHIKATIANPSGAFTDYLIKDNADGTYDVEFTPFEKGLHTVEVTYDDIPVPNSPFQV
AVTEGCHPSRVQAQGPGLKEGFTHKPNPFTVVTRGAGIGGLGITVEGPSESKISCKDNKD
GSCSAEYIPFVPGDYDVNITYGNEHVPGSPFRIPVKDVIDPSKVKIAGPGLGAGVRANVP
QAFTVDSSQAGLAPLEVLVLGPRADETDSLARRSPLRALSDFLRGDPVPCSLGLVEPVTV
TDNGDGTHTVTYTPTQEGPYMVSVKYAGEDVPHSPFKVKVLPTYDASKVTASGPGLSSYG
VPASLPVEFAVDAKKAGVGPLAVQITDQEGKPKRVNVHDNKDGTYAVTYLPDKTGRYMIG
VTYGGDNIPSSPYRIRATQTGDASKCLAKGPGIAPTVKTGEEVGFVVDAKTAGKGKVTCT
VLTPDGAEVEAEVIENEDGTYDIFYTAAKPGTYIIYVRFGGVDIPNSPFTVMATDDDVAV
MKEAPVNACPPGYSPWVTEEAYVPVSDMNGLGFKPFDLVIPFAVRKGEVTGEVHMPSGKT
ATPEIVDNKDGTVTVRYAPTEVGLHEMHIKYMGNHIPESPLQFYVNYPNSGSVSAYGPGL
VYGVANKTATFTIVTEDAGEGGLDLAIEGPSKAEISCIDNKDGTCTVTYLPTLPGDYSIL
VKYNDKHIPGSPFTAKITDNNRRCSQVKLGSAADFLLDISETDLSTLTASIKAPSGRDEP
CLLKRLPNNHIGISFIPREVGEHLVSIKKNGSHVPNSPVSIMVVQSEIGDARRAKVSGRG
LTEGRTFEMSDFIVDTREAGYGGISLAVEGPSKVDIQTEDLEDGTCKVSYFPTVPGVYIV
STKFADEHVPGSPFTVKISGEGRVKESITRASRAPSVATVGSICDLNLKIPEIDSADMSA
HVTSPSGRMTEAEIVPMGKSSHCVRFVPQEMGVHTVSVKYRGQHVTGSPFQFTVGPLGEG
GAQKVRAGGPGLERGEAGVPGEKWIKFNEEHIPESPYWVPVIAPPDDACRLTVMSLQESG
LKVNQPASFAIRLNGAKGKIDAKVHSPSGAVEECHVSELEPGEAGGPERLRGAGGGGGGR
LLPLEPGGLAAHSVPSPSRTFPYSPQALPHLLAPPLDTGQLISFLPEVWRPDLNPILPRL
ENFLAGVQSEFFINTTRAGPGTLSVTIEGPSKVKMDCQETPEGYKVMYTPMAPGSYLIGV
KYGGPNHIVGSPFKAKVTGQRLVSPGSANETSSILVESVTRSSTETCYSAVPKASSDASK
VTSKGAGLVKAFVGQKSTFLVDCSKAGSNMLLIGVHGPTTPCEEVSMKHVGNQQYNVTYV
VKERGDYVLAVKWGEEHIPGSPFHITVP
NT seq 7827 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtgaccgagaaggacctggccgaggacgcgccgtggaagaagatccagcagaac
acgttcacgcgctggtgcaacgagcacctcaagtgcgtgaacaagcgcatcggcaacctg
cagacggacctgagcgacgggctgcggctcatcgcgctgctggaggtgctcagccagaag
cgcatgtaccgcaagtaccaccagcggcccaccttccgccagatgcagctcgagaacgtg
tccgtggcgctcgagttcctggagctggagagcatcaagctcgtgtctatcgatagcaaa
gccattgttgatggaaacctgaagctcattcttggcctggtttggactctcattctccac
tactcgatttccatgcctgtgtgggaagatgaaggagatgatgatgccaagaagcaaacg
ccaaagcagaggctgttaggttggattcaaaacaagatcccgtatttacccatcaccaac
tttaaccagaactggcaagatggcaaagcgttgggagccctcgtggacagctgcgcccca
gggctttgccccgactgggaatcctgggatccctcaaagcctgtggacaatgctcgggaa
gccatgcagcaggcggatgactggctgggagtcccacaggtcatcactcctgaagaaatc
attcaccccaatgtggacgaacactccgtcatgacttacctgtcccagttccccaaagcc
aagctcaagccgggagcccctcttaaacccaaactcaatccgaagaaggccagggcctac
ggccgaggaattgagcccaatgggaacatggtgaagcagccggccaggtttacagtggac
accattagtgccgggcaaggggatgtgatggtgattgtggaagatcccgagggcaacaaa
gaagaggcacaagtgactcccgacggtgataagaacaagacatattctgtggaatatttg
ccaaaggtcacaggacttcacaaagtcacagttctctttgctggtcagcacatctccaag
agtccgtttgaggtcaatgttgacaaagcccagggcgatgccagcaaagtgaccgcaaag
ggaccaggcttggaagcctccggcaacatcgccaataaggccactttctttgacatctac
acagcaggagctggtgtgggagacattgaagtggaagtggaagatccccaaggcaagaaa
acggtagaaatggccatggaagacaagggaaatcaggtctaccgctgtgcttacaaaccc
gttcagtctggtcctcatgtggtcaaggtctcatttgctggagaatccattcccaaaagc
ccctttatggtgaatgttggggaagcctgcaatccaaatgcctgtcgggccagcggacga
ggcctgcagcccaagggggtgcggatccgagagacggccgactttaaggtggacacaaaa
tcggcgggaagcggggagctcagcgtgacggtcagagggcccaaggggctggaggagctc
gtgaaacaaaagggcttcatgaatggcgtttatgcttttgagtactatccaggaactcct
gggaaatacgtcgtggtcatcacgtggggtggacacaacattccaaagagtccctttgaa
gtccaagtgggccctgaggcagatgtccagaaagtaagagcctgggggcctggtctccat
ggaggcatcgttgggaggtccgccgacttcgtggtggagtccattggctcagaagttgga
tccttgggatttgccattgaaggtccatcccaggcaaagattgaatacaatgaccagaat
gatgggtcctgcgatgtgaaatattggcccaaggaaccgggggagtacgccgtccatatc
atgtgtgatgatgaggacatcaaggacagcccttacatggcctacatccagccagcctca
ggagacttcaacccagatttggttcaagcctatggtccaggactagagaagactggctgt
attgtcaacaacttggcagaatttactgttgaccctaaggatgctgggaaagcccccttg
aagatctatgctcaggatggagaaggcaatcctattgatattcaaatgaagagtaagatg
gatgggacctactcctgtttttacacaccgctgaagccgatcaaacatacgattgccgtc
gtttggggaggagtgaatatctcccaaagcccatatagggttggcgttggtcaagggagt
caccctcagagggtcaaagtatttggtcctggtgtagagagaagtggtctaaaagccaat
gagcccactcacttcaccgtagactgtacagaggcaggggaaggtgatgtcagtgttggc
attaaatgtgatgccggagttctgggcatagatgaggaagacgtcgactttgacatcatt
cacaacgccaacgatacgtttacagtgaaatatgcaccccctgctcctggcagatacacc
atcaaagttctctttgcctccaaggaaatccctgccagtcctttccgagtcaaagtcgat
ccttcgcatgacgccagcaaagtgagagcggagggccctgggctcagtaaggcaggggtg
gaaaatggaaaaccaactcacttcaccgtcttcaccaagggggcagggaaagcccccctg
gacgtgcagttcaccgggccccaggccggggtcgccgtccgggatctggacatcatcgac
aactacgactattcccacactgtgaaatacacacccgtccaacagggcagcacacaagtc
ctggtgacctatggtggagatccgattcccaaaagcccttttgtggtagaggtcgctgcc
cccctggatctgagcaagataaagctcaatggactggagaaccgagtggaagttggaaag
gaccaggagttcgtggtggataccaaaggggccggagggcaaggcaaattggacgtgaca
attttgagccccactagacaagtggtaccatgcctggtggcccctgtcgccggcaaagat
tatagcactgtcaagtacatccccaaggaagaaggcttgtatgctgtggatgtgagttat
gatgggaaccccattccagggagcccatttactgtggaagcctccctgcctccggatcca
acaaaggtgaaggcccatggccccgggcttgaaggaggttatgtgggaaatcctgccgag
ttcacaattgacaccaaaggagctggcacagggggcttagggttgacggtagaaggtccg
tgtgaagccaaaatcgaatgctcggacaatggggatgggacctgttcagtctcttacctt
ccaacaaaacctggtgaatactttgtcaacatcctctttgaagaggtccatattcctggg
tctccatttaaagcagacatcgaaatgccctttgatccctccaaagtggtggccagtggc
cctgggctggaacgtgggaaagtgggagaagctggcatcctcaaggtagactgttcagag
gctggatatggtgtcttgggcatggaagctgtatctgatgctggagtcaaagcggatgtc
cacatccagaataataaagatggtacttatgctgtgacctatgtgcctcttgctgcgggc
atgtatacgctgaccctgaattacggaggagagcaagtaccagcgttccctgctcgggtc
aaggtggagccagccatagatacaagcaaaattaaagtctatggacctggcattgaagga
aaagatgtgtttcgggaagccacgaccaacttcacagttgactcccgtcctctgacaaag
gtcggaggagaccatatcaaagccaccatcgccaacccctctggggccttcacggactac
ctcatcaaagacaatgcagatgggacttacgatgttgagttcacaccatttgaaaaaggc
ctccacaccgtggaagtaacatacgatgacatacctgtgcccaatagccccttccaagtg
gcggttactgaaggctgtcacccatctagagtgcaagcccagggacctggattgaaggaa
ggcttcacccacaagcccaatcccttcacggtggttaccagaggagcaggcatcgggggc
cttggcataaccgtggagggaccctcggagtcgaagatcagttgcaaagataacaaagat
ggcagctgtagtgcggaatacatcccgtttgtgccgggagattacgacgttaatatcacg
tacgggaacgagcacgtgcctggcagccccttcaggatccctgtgaaggacgtcatcgac
cccagcaaggtcaagatcgcgggccccggcctgggggcgggcgtcagggccaacgtcccg
caggccttcaccgtggacagcagccaggcgggcctggcccccctggaagtcttggtcttg
gggccccgagcggacgagacggactcgctggcccggcgcagccccctgagagccctttca
gatttcttgagaggggaccctgtcccctgttccctaggcctggtggagccggtgacagtg
acagacaatggagacggcacgcacacggtgacgtacaccccgacccaggaaggcccctac
atggtgtcggtcaagtacgccggcgaggacgtccctcacagtccttttaaggtcaaggtc
ctcccaacatatgatgctagcaaagtgactgcgagtggcccaggcctcagttcctatggg
gttccggccagtttgcctgtggagtttgcagttgatgccaaaaaagccggcgttggaccc
cttgctgtccagataacggaccaagaaggaaagcccaaaagagtcaatgttcatgacaac
aaagatggcacctatgcagtgacctacctccccgacaagacaggccgctatatgatcgga
gtcacgtatggtggggataacatcccatcttctccttaccgaatccgggccactcagact
ggagatgccagcaagtgcttggccaaaggccctggcattgcccctactgtcaaaactggg
gaggaagtcggctttgtggtcgatgccaagactgcaggcaaagggaaggtgacctgtacc
gtcctgactcctgacggcgctgaagtggaggcagaggtcattgagaatgaagatggcacc
tatgacatcttctacacagcggccaagcctggcacctacatcatctacgtgcgctttggc
ggggtggatattcccaacagccccttcaccgtcatggctacagatgatgacgttgccgta
atgaaggaggcgccggtaaatgcatgtccccctggatacagtccttgggtgacggaagaa
gcctacgtccccgtcagtgacatgaatggcctgggatttaagccctttgacctggtcatt
cccttcgctgtaaggaaaggagaagtaactggagaagtgcacatgccctccgggaagacg
gccacccccgagatcgtcgacaacaaagatggcactgtcaccgtccgctacgcgcccacc
gaggtcggcctgcatgagatgcacatcaaatacatgggcaaccacatcccggagagtccc
ctccagttctacgtcaactaccctaatagcggcagcgtgtcagcctacgggcctggcctg
gtgtacggagtcgccaacaagaccgccaccttcaccatcgtcaccgaggacgccggcgag
ggtggactagacttggccatcgaggggccttcgaaggccgagatcagttgcattgacaac
aaagatggtacctgcacggtgacctacttgcccacactccctggcgactacagcatcctc
gtgaaatacaatgacaagcacataccaggcagccccttcacggccaaaatcacagataac
aacaggagatgttcccaagtgaagctgggctcagccgctgacttcctgctggacatcagt
gaaactgacctcagcacactgaccgccagcatcaaagccccgtccgggcgggatgagccc
tgcctcctgaagaggctcccaaacaaccacatcggcatttctttcatccctcgggaagtt
ggggaacacctggtcagcattaagaaaaatggcagccatgtgcccaacagccctgtatcc
atcatggtggtccagtcagagattggagatgcccggagggctaaagtctcaggccggggc
ttgacagaaggacgtacttttgaaatgtcagactttattgttgacacgagggaagcaggt
tacggcggcatatccttggcagtagaaggaccaagcaaggttgacattcagacagaagat
cttgaagatggaacctgcaaggtgtcctacttccctacagtcccaggggtttacattgtg
tccaccaagtttgcagatgaacacgtcccaggcagtcccttcactgtgaaaatcagcgga
gaaggcagggtcaaggaaagtatcacgcgcgcaagccgggcaccatcggtggcaaccgtt
ggtagtatctgtgatctcaacctaaaaatcccagaaatagacagtgcggacatgtcagcc
cacgtcaccagcccttctggccgcatgactgaagcagagattgtacccatggggaagagc
tcccactgtgtccgatttgtaccccaagagatgggggtacacacagtgagcgtcaaatac
cgagggcaacatgtgacgggaagccctttccaattcactgttgggcctctcggggaaggg
ggtgcccagaaagtccgagctgggggccccggccttgagagaggtgaagcaggagtacca
ggtgagaaatggatcaagttcaacgaggagcacattcccgagagcccctattgggttccg
gtcatcgccccgcccgacgatgcctgcagactcactgtcatgagcctccaggaatcggga
ctgaaagtgaaccagccagcctccttcgccatcaggctgaacggggccaaaggcaagatc
gacgccaaagtgcacagcccgtcgggggctgtcgaggagtgccacgtctccgagctggag
ccaggtgaggcgggggggcccgagcggcttcggggagccgggggggggggggggggccgt
ctcttgcccctggagcctggtgggctggctgcccactcggtgccttctccaagccgaacg
ttcccttacagcccgcaggctctgccccatttactggcgcctcctctggacactggccag
cttatcagcttccttcctgaagtgtggcgcccagacctgaacccaatccttccgagactt
gagaacttccttgcaggcgtccaatcggagtttttcatcaataccaccagagctggccca
gggacgttgtctgttacaattgaagggccatccaaggtcaagatggactgccaggaaact
ccagaaggctacaaagtcatgtatacgccgatggctccaggcagttatctaattggtgtg
aaatatggcgggcctaaccacattgttggcagccctttcaaggccaaagtgacaggccaa
cgcctcgtcagcccgggctctgccaatgagacgtcttccatcctggtagagtcggtgacc
aggtcctccaccgaaacctgctacagtgccgtgcccaaagcttcctcggatgccagcaag
gtgacatccaagggagcggggctcgtgaaagctttcgtgggccagaagagcaccttcctg
gtcgactgcagcaaggcgggatccaacatgttattgattggcgtccacggccccaccacg
ccttgtgaagaagtctctatgaagcacgttgggaaccagcagtataacgtgacgtacgtc
gtcaaagagaggggcgactacgttttggccgtcaagtggggcgaggagcatattcctggg
agcccctttcatatcacagtgccttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system