KEGG   Monodelphis domestica (opossum): 100014196Help
Entry
100014196         CDS       T01031                                 

Gene name
SCD
Definition
stearoyl-CoA desaturase (delta-9-desaturase)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
PPAR signaling pathway
AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    100014196 (SCD)
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    100014196 (SCD)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    100014196 (SCD)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    100014196 (SCD)
Enzymes [BR:mdo01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     100014196 (SCD)
Lipid biosynthesis proteins [BR:mdo01004]
 Desaturase
  First
   100014196 (SCD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 363 aa AA seqDB search
MPAHLLQEEISPSYTMTTTTTITAPSNRALQNGAARAASKTPMGQEKEEVNYEMRDDMFD
PTYREKEGPKPKFIYVWRNIILMGMLHLGAIYGLFLLPSAQLYTLLFAFVYYMTSALGIT
AGAHRLWSHRTYKARLPLRVFLTIANTMAFQNDIYEWARDHRVHHKFSETDADPHNAQRG
FFFSHVGWLLVRKHPDVIEKGRLLDMSDLKAEKLVMFQRRHYKLGILFLCFLIPTFIPYY
FWGENFSHSLFISTLLRYTVVLNATWLVNSAAHMYGSRPYDKNINPRENMLVALGAAGEG
FHNYHHTFPYDYSASEYRWHLNFTTFFIDCMCFLGLAYDRKKVSKAAILARCSRTGEGSA
KSG
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgccggcccacttgctacaggaggagatatccccctcctacaccatgaccaccaccacc
accatcacagccccttccaacagggccctgcagaatggcgcagcccgggcggcctccaag
acccccatggggcaggagaaagaagaggtcaactatgagatgagagatgacatgttcgac
ccgacatacagggagaaggagggccccaagcccaaattcatctacgtgtggaggaacatc
atcctcatgggcatgctgcacttgggagccatctatgggctcttcctgctgccctcagcc
caattgtacaccctgctctttgcctttgtatactatatgacgagcgccctgggcatcact
gcaggagcccaccgcctctggagccataggacctacaaggcacgcctgcccctcagagtc
tttctgacgatcgctaacaccatggcattccagaatgacatctacgagtgggcccgggac
catcgtgtgcatcacaagttctctgagacagatgctgatccccataatgcccagcgggga
tttttcttctcccacgtgggctggctgctggtccgaaaacatccagatgtcattgagaag
ggccgtttgcttgacatgtctgatctgaaagctgagaagctggtgatgttccaaaggagg
cactacaagctcggcatccttttcttgtgtttcctcatccccacgttcatcccttactac
ttctggggggagaacttttctcacagcctgtttatttccaccctcctacgttataccgtc
gtgctcaatgccacctggctggtgaacagcgctgctcacatgtatggcagccgaccctat
gacaaaaacatcaacccccgagagaatatgctcgtggcccttggagctgcaggtgaaggc
ttccacaactaccatcacaccttcccctatgattactccgctagtgagtaccgctggcac
cttaactttaccaccttcttcatcgactgcatgtgtttcctcggcttggcctacgaccga
aagaaagtctccaaggcagctatccttgccagatgctccagaactggggaagggagcgct
aagagcggctga

DBGET integrated database retrieval system