KEGG   Monodelphis domestica (opossum): 100014215Help
Entry
100014215         CDS       T01031                                 

Gene name
GCNT4
Definition
glucosaminyl (N-acetyl) transferase 4, core 2
Orthology
K09663  
beta-1,6-N-acetylglucosaminyltransferase 4 [EC:2.4.1.-]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Mucin type O-Glycan biosynthesis
Metabolic pathways
Class
Metabolism; Glycan biosynthesis and metabolism; Mucin type O-glycan biosynthesis [PATH:mdo00512]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 520 aa AA seqDB search
MYHFLIVRGEGRTVGCSTPPSRNFWLSLSFYKLNFYLFXLLKLYIFITSFQYGYTNSQVT
NSVSIMKGYVCSSKYPLRQKIFILFLTLWLFSLLKLLNVKGSFFSRKGIYLVERSLSTSS
YVRNKYTFVRGEYRYKINCSRIYEQEPVEIGKTLEIRKKDIIDLDDEDVVEMTKDCKVYQ
TIRRYHLKTVSTEEQKFPIAYSLVVHKDAIMVERLIHAIYNSHNVYCIHYDQKSRSTFKL
AMDNIARCFSNIFIASKLETVEYAHISRLQADFNCLSDLLKSHVPWKYVINLCGQDFPLK
SNFELVTELKKLNGANMLESVKPSSTKKERFIYHHELKIVPYDYTVMPVRTNISKEAPPH
NIEIFVGSAYFVLSRAFINYTFNNPLAKDLFEWSKDTYSPDEHFWATMIRVPGIPGEISR
SAQDVTDLQSKTRLVKWNYLEDHFYPPCTGSHLRSVCIYGAAELRWLMKYGHWFANKFDS
KVDPVLIKCLAEKLEEQQREWVRLSSEKLFMIGTPTTVSL
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgtatcacttcctgattgtccggggggaggggaggacagtaggatgcagcaccccacca
tctagaaatttttggctttccctttctttttacaaactaaacttttatttattttaactt
ttaaaattgtatatatttataacttctttccagtatggttataccaattcacaggtcacc
aacagtgtgtcaataatgaagggatacgtgtgctcttctaaataccctctgcgacagaag
attttcatactgtttttgacactatggttgttctctttattgaaacttttaaacgtgaaa
ggatctttcttctcaagaaaaggcatttacttagtcgaacgatctttaagcacttcatcc
tatgtaagaaacaagtatacttttgtcagaggtgaatacaggtacaaaattaactgttcc
cgtatttatgagcaagagcctgtggagattggcaagacactggagataaggaagaaagac
atcattgatttagatgatgaagatgttgtagaaatgaccaaagattgtaaggtctatcag
accataagaagataccacctgaagactgtttcaacagaagagcaaaaattcccaatagct
tattctttggtagttcacaaagatgccatcatggttgaaagattgatccatgcaatatac
aacagtcacaatgtttattgtattcattatgatcagaaatcacgttccactttcaaactt
gccatggacaatatagctaggtgcttttccaacattttcatcgcttccaaattagagaca
gtggaatatgctcacatttccaggctccaagctgattttaattgcttgtctgacctgctg
aaatcccatgttccttggaagtatgttattaacctgtgtgggcaagattttcctttaaaa
tcaaactttgaattagtaactgagttgaaaaaactaaatggagcaaatatgctcgagtca
gtgaagccaagtagcaccaaaaaggaaagattcatttatcaccatgaactcaaaattgtg
ccttatgactacacagtaatgcctgtaaggacaaacatttccaaggaagctccacctcat
aacattgagattttcgtgggtagtgcttattttgttttaagccgagccttcattaactat
actttcaataacccccttgctaaagacttatttgagtggtctaaagatacatactcccca
gatgagcatttctgggccaccatgatccgagtaccaggaatacccggggagatatccaga
tcagcacaagatgtcacagacttacaaagtaaaactcgactggtcaaatggaattactta
gaagaccatttctatcctccctgtactggctctcatcttcgtagtgtatgtatctatggg
gcagctgaattaagatggcttatgaaatatggacactggtttgccaataaatttgattcc
aaggtggacccagttttaattaaatgtttggccgaaaagcttgaagaacagcagagagag
tgggttcgtttatcttcagaaaaattatttatgattggaactcccacaactgtgtcactg
tag

DBGET integrated database retrieval system