KEGG   Monodelphis domestica (opossum): 100014215Help
Entry
100014215         CDS       T01031                                 

Gene name
GCNT4
Definition
glucosaminyl (N-acetyl) transferase 4, core 2
Orthology
K09663  
beta-1,6-N-acetylglucosaminyltransferase 4 [EC:2.4.1.-]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Mucin type O-Glycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    100014215 (GCNT4)
Enzymes [BR:mdo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     100014215 (GCNT4)
Glycosyltransferases [BR:mdo01003]
 Glycan extension
  O-Glycan
   100014215 (GCNT4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 455 aa AA seqDB search
MKGYVCSSKYPLRQKIFILFLTLWLFSLLKLLNVKGSFFSRKGIYLVERSLSTSSYVRNK
YTFVRGEYRYKINCSRIYEQEPVEIGKTLEIRKKDIIDLDDEDVVEMTKDCKVYQTIRRY
HLKTVSTEEQKFPIAYSLVVHKDAIMVERLIHAIYNSHNVYCIHYDQKSRSTFKLAMDNI
ARCFSNIFIASKLETVEYAHISRLQADFNCLSDLLKSHVPWKYVINLCGQDFPLKSNFEL
VTELKKLNGANMLESVKPSSTKKERFIYHHELKIVPYDYTVMPVRTNISKEAPPHNIEIF
VGSAYFVLSRAFINYTFNNPLAKDLFEWSKDTYSPDEHFWATMIRVPGIPGEISRSAQDV
TDLQSKTRLVKWNYLEDHFYPPCTGSHLRSVCIYGAAELRWLMKYGHWFANKFDSKVDPV
LIKCLAEKLEEQQREWVRLSSEKLFMIGTPTTVSL
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgaagggatacgtgtgctcttctaaataccctctgcgacagaagattttcatactgttt
ttgacactatggttgttctctttattgaaacttttaaacgtgaaaggatctttcttctca
agaaaaggcatttacttagtcgaacgatctttaagcacttcatcctatgtaagaaacaag
tatacttttgtcagaggtgaatacaggtacaaaattaactgttcccgtatttatgagcaa
gagcctgtggagattggcaagacactggagataaggaagaaagacatcattgatttagat
gatgaagatgttgtagaaatgaccaaagattgtaaggtctatcagaccataagaagatac
cacctgaagactgtttcaacagaagagcaaaaattcccaatagcttattctttggtagtt
cacaaagatgccatcatggttgaaagattgatccatgcaatatacaacagtcacaatgtt
tattgtattcattatgatcagaaatcacgttccactttcaaacttgccatggacaatata
gctaggtgcttttccaacattttcatcgcttccaaattagagacagtggaatatgctcac
atttccaggctccaagctgattttaattgcttgtctgacctgctgaaatcccatgttcct
tggaagtatgttattaacctgtgtgggcaagattttcctttaaaatcaaactttgaatta
gtaactgagttgaaaaaactaaatggagcaaatatgctcgagtcagtgaagccaagtagc
accaaaaaggaaagattcatttatcaccatgaactcaaaattgtgccttatgactacaca
gtaatgcctgtaaggacaaacatttccaaggaagctccacctcataacattgagattttc
gtgggtagtgcttattttgttttaagccgagccttcattaactatactttcaataacccc
cttgctaaagacttatttgagtggtctaaagatacatactccccagatgagcatttctgg
gccaccatgatccgagtaccaggaatacccggggagatatccagatcagcacaagatgtc
acagacttacaaagtaaaactcgactggtcaaatggaattacttagaagaccatttctat
cctccctgtactggctctcatcttcgtagtgtatgtatctatggggcagctgaattaaga
tggcttatgaaatatggacactggtttgccaataaatttgattccaaggtggacccagtt
ttaattaaatgtttggccgaaaagcttgaagaacagcagagagagtgggttcgtttatct
tcagaaaaattatttatgattggaactcccacaactgtgtcactgtag

DBGET integrated database retrieval system