KEGG   Monodelphis domestica (opossum): 100014462Help
Entry
100014462         CDS       T01031                                 

Definition
lymphokine-activated killer T-cell-originated protein kinase-like
Orthology
K08865  
PDZ-binding kinase [EC:2.7.12.2]
Organism
mdo  Monodelphis domestica (opossum)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
6
AA seq 323 aa AA seqDB search
MEGPNPFKTPSKLPEKKKSSSCLTPSSVAIPASPFMKKLGYGTGVNVYLMKKSPKGLSRS
PWAVKKINSKCNDHYQSIYQKRLNDEAKILKDLQHPNIVGYQAFAPAQDGSMCRAMEYGG
EKSLNDLIEERNTNCHSPFPAAIILKVALHMARGLKYLHQEKKLLHGDIKSSNVVIKGDF
EAIKICDVGVSLPLDENMTVSDPEAHYISTEPWKPKEALEECGIITDKADIFAFGLTLWE
MLTLTIPHVNLPEDEDDEDKIFDESMFDDEAYYEALGTRPAINMEELDESYQKVIELFSI
CTNENPKDRPSAAYIVEALEINM
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggaaggaccaaatcccttcaagacacctagcaaattacctgagaagaagaaatcttca
tcatgcttaactccatcatctgtagctattccagcttctccatttatgaaaaagcttggc
tatggcactggagtaaatgtttaccttatgaaaaagtctcccaaaggcttgtctcgttct
ccttgggcagtgaaaaagattaattccaaatgtaatgatcattatcaaagtatatatcaa
aagagactaaatgatgaagctaagattttgaaagaccttcagcatccaaacattgtaggt
tatcaggcatttgctccagcccaggatggaagtatgtgtcgtgctatggagtatggagga
gaaaagtctctcaatgacttaattgaggaaagaaataccaactgccattctcctttccca
gctgctataattttgaaggttgctttgcacatggcaagggggttaaagtatctgcaccaa
gaaaagaagctcctacatggagatataaagtcttcaaatgtcgtaattaaaggtgatttt
gaagcaattaaaatctgtgacgtaggagtctcactgccactggatgaaaatatgactgtg
agtgaccctgaggcgcattacattagcacagaaccctggaaaccaaaggaagctctggaa
gaatgtggtatcattactgataaagctgacatatttgcctttggcctaactctttgggag
atgttgaccctaaccattccacatgttaatcttccagaggatgaggatgatgaagacaaa
atttttgatgagagcatgtttgatgatgaagcatactatgaagcactgggaacaaggcca
gccattaatatggaagaattggatgaatcatatcaaaaagtaattgaactgttttctatt
tgcactaatgagaatcctaaagaccgtccctcagctgcatacatagttgaagctttggaa
ataaatatgtaa

DBGET integrated database retrieval system