KEGG   Monodelphis domestica (opossum): 100014462Help
Entry
100014462         CDS       T01031                                 

Definition
(RefSeq) lymphokine-activated killer T-cell-originated protein kinase-like
  KO
K08865  
PDZ-binding kinase [EC:2.7.12.2]
Organism
mdo  Monodelphis domestica (opossum)
Brite
Enzymes [BR:mdo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100014462
Protein kinases [BR:mdo01001]
 Serine/threonine protein kinases: Other group
  TOPK family
   100014462
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
6
AA seq 323 aa AA seqDB search
MEGPNPFKTPSKLPEKKKSSSCLTPSSVAIPASPFMKKLGYGTGVNVYLMKKSPKGLSRS
PWAVKKINSKCNDHYQSIYQKRLNDEAKILKDLQHPNIVGYQAFAPAQDGSMCRAMEYGG
EKSLNDLIEERNTNCHSPFPAAIILKVALHMARGLKYLHQEKKLLHGDIKSSNVVIKGDF
EAIKICDVGVSLPLDENMTVSDPEAHYISTEPWKPKEALEECGIITDKADIFAFGLTLWE
MLTLTIPHVNLPEDEDDEDKIFDESMFDDEAYYEALGTRPAINMEELDESYQKVIELFSI
CTNENPKDRPSAAYIVEALEINM
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggaaggaccaaatcccttcaagacacctagcaaattacctgagaagaagaaatcttca
tcatgcttaactccatcatctgtagctattccagcttctccatttatgaaaaagcttggc
tatggcactggagtaaatgtttaccttatgaaaaagtctcccaaaggcttgtctcgttct
ccttgggcagtgaaaaagattaattccaaatgtaatgatcattatcaaagtatatatcaa
aagagactaaatgatgaagctaagattttgaaagaccttcagcatccaaacattgtaggt
tatcaggcatttgctccagcccaggatggaagtatgtgtcgtgctatggagtatggagga
gaaaagtctctcaatgacttaattgaggaaagaaataccaactgccattctcctttccca
gctgctataattttgaaggttgctttgcacatggcaagggggttaaagtatctgcaccaa
gaaaagaagctcctacatggagatataaagtcttcaaatgtcgtaattaaaggtgatttt
gaagcaattaaaatctgtgacgtaggagtctcactgccactggatgaaaatatgactgtg
agtgaccctgaggcgcattacattagcacagaaccctggaaaccaaaggaagctctggaa
gaatgtggtatcattactgataaagctgacatatttgcctttggcctaactctttgggag
atgttgaccctaaccattccacatgttaatcttccagaggatgaggatgatgaagacaaa
atttttgatgagagcatgtttgatgatgaagcatactatgaagcactgggaacaaggcca
gccattaatatggaagaattggatgaatcatatcaaaaagtaattgaactgttttctatt
tgcactaatgagaatcctaaagaccgtccctcagctgcatacatagttgaagctttggaa
ataaatatgtaa

DBGET integrated database retrieval system