KEGG   Monodelphis domestica (opossum): 100014496Help
Entry
100014496         CDS       T01031                                 

Definition
replication protein A 32 kDa subunit-like
Orthology
K10739  
replication factor A2
Organism
mdo  Monodelphis domestica (opossum)
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Fanconi anemia pathway
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    100014496
   03420 Nucleotide excision repair
    100014496
   03430 Mismatch repair
    100014496
   03440 Homologous recombination
    100014496
   03460 Fanconi anemia pathway
    100014496
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 275 aa AA seqDB search
MWNSGFDGNYGSSSYSSGGYTQPPGGFGTPTASQAEKKSRARAQHIVPCTISQLLSATLV
DEVFKIGEIEISQVTIVGIIRQAEKAPTNIVYKIDDMTAAPMDVRQWVDTDDTSSENTVV
PPETYVKVAGHLRSFQNKKSLVAFKILPLEDMNEFTIHILETVNAHMVLSQSISQPLAGR
PSLNTSGIGDTGGFGGNSFSGNNFMPANGLTVTQNQVLNLIKACPRPEGMNFQDLKTQLH
NVNVSVIKQAVDFLSNEGHIYSTVDDDHFKSTDAE
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgtggaatagtggatttgatggaaactatgggagctcttcctactcgagtggtggttac
acacagcccccagggggatttggcactcctactgcttctcaggccgaaaagaagtctaga
gccagagcccagcacattgtcccttgcaccatatcacaactcctttctgccaccctggtt
gatgaagtatttaagattggggagattgagatttcacaggtcactattgtgggaataatc
cgacaagcagagaaggccccaactaacattgtctacaaaatagatgatatgaccgctgca
ccaatggatgttcgacagtgggtggacactgatgacacaagcagtgaaaatactgtggta
ccaccagaaacctacgtaaaagtggctggtcatctcaggtctttccagaacaaaaagagc
ctggtggcattcaagattcttcctctggaggacatgaatgagtttactatacatatcctg
gaaaccgtcaatgcacatatggttctaagtcaatctatcagccagcccttggcaggaaga
ccatctctcaacacttctggaataggagatacaggaggttttggaggaaacagctttagc
gggaacaattttatgccggccaatggcctcactgtaacccagaaccaggtactgaatttg
attaaagcttgcccaaggccagaaggcatgaattttcaggatctcaagactcagttgcac
aacgtgaatgtgtctgtaatcaagcaagctgttgattttctcagcaatgaaggccacatc
tattccactgtggacgacgaccacttcaaatccacagacgcggagtga

DBGET integrated database retrieval system