KEGG   Monodelphis domestica (opossum): 100014568Help
Entry
100014568         CDS       T01031                                 

Gene name
PRKG2
Definition
protein kinase, cGMP-dependent, type II
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
cGMP-PKG signaling pathway
Gap junction
Platelet activation
Circadian entrainment
Long-term depression
Olfactory transduction
Salivary secretion
Module
cGMP signaling
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    100014568 (PRKG2)
 Cellular Processes
  Cellular commiunity
   04540 Gap junction
    100014568 (PRKG2)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100014568 (PRKG2)
  Digestive system
   04970 Salivary secretion
    100014568 (PRKG2)
  Nervous system
   04730 Long-term depression
    100014568 (PRKG2)
  Sensory system
   04740 Olfactory transduction
    100014568 (PRKG2)
  Environmental adaptation
   04713 Circadian entrainment
    100014568 (PRKG2)
Enzymes [BR:mdo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     100014568 (PRKG2)
Protein kinases [BR:mdo01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   100014568 (PRKG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
5
AA seq 759 aa AA seqDB search
MGNGSVKPKQSKIPDGHAGKLSGTIDALRSKVTELERELKKKDDELQQREYHLRELQEKL
SKQTIALAEITEELQNKCIQLNKLQDVVNIQGGNSLLFSPYKVPLQVNRRTSGLVSLHSR
RGAKEGVSAEPTTRTFAEFSFEKARVRKDSSDKKLITDALNKNQFLKRLDPQQIKDMVEC
MYGRNYPQGSYIIKQGEPGNHIFVLAEGRLEVFQGNKLLSSIPMWTTFGELAILYNCTRT
ASVKAISNVKTWALDREVFQNIMRRTAQARDEQYRQFLRSVCLLKNLPEDKLTKIIDCLE
VEYYDKGDYIIREGEEGSTFFILAKGVVKVTQSTEGYDQPQLIKTLKKGDYFGEKALISD
DVRSANIIAEENDVACLVIDRETFSQTVGTFEELQKYLEGYVANLNRDDEKRHAKRSMSG
WRQTKALSLEMIQLKEKVAKFSSSSPFQNLEIVTTLGVGGFGRVELVKVKNENVAFAMKC
IRKKHIVDTKQQEHIYSEKKILEEMCSPFIVKFYRTFKDRKYVYMLLEACLGGELWSILR
DRGSFDEPTSKFCVACVTEAFDYLHRLGIIYRDLKPENLILDAEGYLKLVDFGFAKKIGS
GQKTWTFCGTPEYVAPEVILNKGHDFSVDFWSLGILVYELLTGNPPFSGIDQMMTYNLIL
KGIEKIDFPKKITRRPEDLIRRLCRQNPTERLGNLKNGINDIKRHRWLNGFNWEGLKARS
LPSPLKRELSGPIDHSYFDNYPPEKGIPPDELSGWDKDF
NT seq 2280 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatggctctgtgaaacccaaacagtccaagattccagatggccatgctgggaaa
ttgtcaggcacaattgatgctcttcggagcaaagtgacagaattggaaagggagctaaag
aagaaggatgatgagctacagcagagggagtaccatctgagggagctgcaggaaaagctc
tccaagcagacaatcgctcttgcggagatcactgaggaactccaaaacaagtgtatccag
ctaaacaagcttcaagatgtagttaacattcagggaggaaactcacttctattttctcca
tacaaagtgcctcttcaggtcaaccgaaggacctcaggcttagtctctctccacagcagg
agaggtgccaaggaaggagtatctgctgaaccaactaccaggacctttgcagaattttca
tttgagaaagcaagagtcaggaaggactcaagtgataagaagctcatcacagatgccctg
aataaaaatcagtttttgaagagactggaccctcagcagatcaaagacatggtggaatgt
atgtatggaagaaactacccacaaggcagttatatcattaaacaaggagaaccaggaaat
catatttttgtattggcagagggaagactagaagtattccaagggaacaagcttctgtca
tcaattcctatgtggacaacatttggagaactagccatattatacaactgtacaaggacg
gcttcagtaaaagctatctccaatgtgaaaacgtgggcactagatagagaagtattccag
aatattatgagaagaacagctcaagctcgggatgaacagtacagacagttccttaggagc
gtatgtttgctgaagaacttacctgaagacaaactaaccaaaatcattgactgcttggaa
gtggaatactatgacaaaggagattatatcatcagagaaggggaggaaggaagcaccttt
ttcattttagcaaaaggagtggtaaaagttactcagagtacagaagggtatgatcaacct
cagttgattaaaacactgaaaaaaggtgattactttggagaaaaggctctcatcagtgat
gatgtcaggtcagctaatatcattgcagaagaaaatgatgtggcatgcctggttattgat
cgcgaaacattcagtcaaacagttggaacctttgaggagctccaaaagtatcttgaggga
tatgtggcgaacttgaaccgtgatgatgaaaaaaggcatgccaagagatctatgtctggc
tggaggcaaaccaaagccctgtctctggagatgattcaactaaaggagaaagtggccaaa
ttttcttcttcgtccccattccagaaccttgagattgtcaccacactgggtgtcggtggg
ttcggaagagttgaacttgtaaaagtaaaaaatgagaatgtggcatttgctatgaagtgt
ataaggaagaagcacattgttgatactaagcaacaggaacatatctattcagaaaagaag
attctggaagagatgtgctctccatttattgttaagttttatcgtactttcaaggacaga
aaatatgtgtatatgctcttggaggcctgcttaggtggagaattgtggagtatcctaagg
gacaggggcagctttgatgagcccacttctaagttctgtgttgcctgtgtgacagaagca
tttgattatttgcatcgcctgggtattatctacagggatttaaagccagagaatttaatt
ctagatgcggagggataccttaagctggttgattttggatttgctaagaagatcggatct
ggacagaaaacttggacattctgcgggacccccgagtatgtagctcccgaagtcattctc
aacaaagggcatgacttcagtgtggacttttggtcactaggaattctagtctatgagctg
ctgactggcaatcctccattttctgggattgaccaaatgatgacttataatttaattctc
aaaggaattgagaaaatcgattttcctaagaagataacaagacgccctgaagatttgatt
cggcgactttgcaggcaaaatcctacagaaaggctgggaaacctgaaaaatggaatcaat
gacattaagaggcacaggtggctgaatggctttaactgggaggggctgaaggcaaggagc
ctgccatcacccttaaaaagggagctcagcggacccatagatcacagctactttgacaac
tacccacctgagaaagggataccacccgacgagctgtccggctgggataaagacttctga

DBGET integrated database retrieval system