KEGG   Monodelphis domestica (opossum): 100014659Help
Entry
100014659         CDS       T01031                                 

Gene name
PTPN7
Definition
protein tyrosine phosphatase, non-receptor type 7
Orthology
K18019  
tyrosine-protein phosphatase non-receptor type 7 [EC:3.1.3.48]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100014659 (PTPN7)
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     100014659 (PTPN7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 360 aa AA seqDB search
MVQACGECSRAQPTALPQGATMAQPPAPSSTVKKHIRLQERRGSSVALILDVSSLGAVEP
ICSVSTPRELTLHFLKTTRHPLTRWALQHQPPSPKQLEEEFSKIPPNFVNPEELDIPGHA
SKDRYKTILPNPQSRVCLGRAQSQEDGDYINANYIRGYDGREKVYIATQGPMPNTVSDFW
EMVWQEEVSLIIMLTQLREGKEKCVHYWPTEEETYGPFQIRVQEVNERPEYIVRHLTIQY
QEECRSIKHILFSAWPDHQTPESAGPLLRLVAEVEESPDTAVSSGPIVVHCSAGIGRTGC
FIATRIGCQQLKARGEVDILGIVCQLRLDRGGMIQTSEQYQFLHHTLALYAAQLPEEPNP
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggtccaggcctgtggggagtgctccagagctcagccgacggctctgccacagggggcc
accatggcccagccccctgcccccagctctacagtcaagaaacacatcagactgcaggag
aggagaggctccagtgtggctctgatcttggatgtgagctctctgggggcagtggagccc
atctgctcagtgtctacgccccgagagctcactctccacttcttaaagaccactaggcac
cccctcacccgctgggccctgcagcaccagccacccagccctaagcaactggaggaagag
ttctcgaagattccccccaactttgtcaaccctgaagaactggacattccaggccatgcc
tctaaggaccgatacaagaccatcctgccaaatccccaaagccgtgtctgtcttgggagg
gcacagagccaagaggatggggactacatcaatgccaactatatccgaggctatgatggt
cgtgagaaagtttacattgcaacccagggccccatgcctaatactgtgtctgacttctgg
gaaatggtgtggcaagaagaagtatctctcattatcatgctcacccaacttcgagagggc
aaagagaaatgtgttcactattggcctacagaggaggaaacctatgggccgttccagata
cgggtccaggaagtgaatgaacgcccagaatatattgtccggcaccttactattcagtac
caggaggagtgtcgctcaataaagcacatcctcttctctgcctggcctgatcaccagacc
ccggagtcagctgggcccctcttacgcctggtggctgaggtggaggagagcccagacaca
gcagtcagctccgggcctattgtggttcattgcagtgctggaattggccgaactggctgc
ttcattgccacacggattggctgccaacagctgaaggctcgaggggaagtagatatcctg
ggcatcgtatgccagcttcggctagacagggggggtatgatccagaccagtgagcaatac
cagttcctgcaccacaccctggccttgtatgctgcccagctgcctgaggaaccaaatccc
tga

DBGET integrated database retrieval system