KEGG   Monodelphis domestica (opossum): 100014844Help
Entry
100014844         CDS       T01031                                 

Definition
dual specificity tyrosine-phosphorylation-regulated kinase 3-like
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
mdo  Monodelphis domestica (opossum)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 588 aa AA seqDB search
MGGAARGPGRKDAEPPRAGPPVQEPRRLGDGMYDTFMMLDETKCPPGPNIACNPSEPALP
RRLFITTEKLTTSHSQPILCGGNVKVEQLFQDFDNRRASALQSTVSNTSEKCPTVISQGK
SSDSLNTVKSSSSSKALKVVPLTPEQALKQYKHHLTPYEKLEIINYPEVYFVGPNAKKRH
GVVGGPNNGGYDDAEGGYIHVPRDHLAYRYEVLKIIGKGSFGQVARVYDHKLHQYVALKM
VRNEKRFHRQAAEEIKILEHLKKQDKTGSMNVIHMLESFTFRNHVCMAFELLSMDLYELI
KKNKFQGFSVQLVRKFAQSILQSLDALHRNKIIHCDLKPENILLKQHGRSATKVIDFGSS
CFEYQKLYTYIQSRFYRAPEIILGSRYSTPIDVWSFGCILAELLTGQPLFPGEDEGDQLA
CIMELLGMPPPKLLEQAKRAKYFINSKGLPRYCTMTTQADGRAVLVGGRSRRGKKRGPPG
SRDWMTALKGCDDYLFIEFLKRCLHWDPSARLTPAQALRHPWISKPVPKPLHTDKMSGKR
IVNPVNALQGLGSKLPPVTGIASKLKANLMSETNGGIPLCSVLPKLIS
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgggcggtgctgcccgcgggcccggcagaaaggatgcggagccaccgcgagctgggccc
ccagtccaggaaccgcggaggttgggggatggcatgtatgataccttcatgatgttagat
gaaactaaatgtccacctggcccaaatatagcctgcaatccgtctgaaccagctttaccc
agaagattatttattactactgaaaagctaacaacaagtcacagtcaaccaatcctttgc
ggtgggaatgtgaaggtggaacagctgtttcaggactttgacaacagaagagccagtgct
cttcagtccacagtatcaaatacctctgaaaagtgtcctactgtcatttctcagggtaaa
agttcagacagtttaaatactgtcaaatctagtagttcctccaaagcactaaaagtggta
cctctgactcctgaacaagcactaaagcagtataaacatcacctgactccttatgaaaag
ctcgaaatcatcaattatcctgaagtttattttgtgggtccaaatgctaagaaaaggcat
ggcgttgttggtggccccaacaatgggggctatgatgatgctgagggaggctacattcat
gtaccccgagatcacttggcttatagatacgaggtgctgaaaatcattggcaaaggcagc
tttggccaggttgctcgagtctatgaccacaagcttcaccagtatgttgccctgaaaatg
gttcgcaatgaaaagcgctttcatcgacaagcagccgaggaaatcaagattttagagcat
cttaagaaacaggataaaacaggcagcatgaatgttattcacatgctagaaagctttaca
ttccggaatcatgtctgtatggcctttgaactgctaagcatggacctctatgaactaatc
aaaaagaacaaatttcagggttttagtgtacagctggtgcgtaaatttgctcaatctatc
ttgcaatccctggatgctctccacagaaacaagatcattcactgcgacctgaagccagaa
aacattcttctcaaacagcatggccgcagtgcaactaaggtcattgactttgggtccagt
tgttttgagtaccagaaactctacacatacatccagtctcgtttctacagagcgccagag
atcatcctgggaagtcgatacagtacacctattgatgtgtggagttttggctgcattctt
gcagaacttttgactggacagcctcttttccctggagaggatgagggagaccagttagct
tgtataatggagcttctagggatgccccctccaaaacttctggagcaagcaaagcgtgcc
aagtactttatcaactccaagggcctgccccgatattgtacgatgaccacgcaggcagat
gggagggctgtcctagtggggggtcgttcacgccggggtaagaagcgagggcccccaggc
agcagagactggatgacagccctaaaagggtgtgatgattatttgttcatagagttcttg
aaaagatgcctccattgggacccctctgcccgcctgactccagctcaggccttaagacac
ccttggattagtaaacctgtgcccaaacctctccatacagacaaaatgtcagggaaacga
atagtaaatcctgtcaatgctttgcagggattgggttccaaattgcctccagtcactgga
atagcaagcaaacttaaagctaacttaatgtcagaaactaatggtggtatacctctgtgc
agtgttctgcccaaactcatcagctag

DBGET integrated database retrieval system