KEGG   Monodelphis domestica (opossum): 100014853Help
Entry
100014853         CDS       T01031                                 

Definition
DNA polymerase delta subunit 4-like
Orthology
K03505  
DNA polymerase delta subunit 4
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
HTLV-I infection
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:mdo00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:mdo00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:mdo03030]
Genetic Information Processing; Replication and repair; Base excision repair [PATH:mdo03410]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:mdo03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:mdo03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:mdo03440]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:mdo05166]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
8
AA seq 129 aa AA seqDB search
MGRKRRLITDSFPRVKRRRKGGPGPGKGDRAPEPGLRGGGEGQDAAQGSRGEEPGDEAGV
VLEEKSHLEILRQFDLDLFFGPCTGITRLQRWERAEHLGLDPPQEVLKVLWAHPEDAQYQ
CSLWYLYPI
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgggccggaagaggaggctcatcaccgactccttccccagagtgaagaggaggaggaag
ggcgggccgggtcctggcaagggggacagggcgcccgagccagggctgcgaggtgggggc
gagggccaggacgcggcacagggcagcagaggggaggagccaggggatgaggccggtgta
gtcctggaggagaaaagccacttggagatactgaggcaatttgacctggacctctttttc
gggccctgtacaggtatcactcgactccaaagatgggaacgagcagagcatctgggcctg
gacccaccccaggaggtgctcaaggtgctttgggcccaccctgaagatgcccagtaccag
tgcagcctctggtacctgtaccccatctaa

DBGET integrated database retrieval system