KEGG   Monodelphis domestica (opossum): 100014853Help
Entry
100014853         CDS       T01031                                 

Gene name
POLD4
Definition
polymerase (DNA-directed), delta 4, accessory subunit
Orthology
K03505  
DNA polymerase delta subunit 4
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
HTLV-I infection
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    100014853 (POLD4)
   00240 Pyrimidine metabolism
    100014853 (POLD4)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    100014853 (POLD4)
   03410 Base excision repair
    100014853 (POLD4)
   03420 Nucleotide excision repair
    100014853 (POLD4)
   03430 Mismatch repair
    100014853 (POLD4)
   03440 Homologous recombination
    100014853 (POLD4)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    100014853 (POLD4)
DNA repair and recombination proteins [BR:mdo03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      100014853 (POLD4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
8
AA seq 129 aa AA seqDB search
MGRKRRLITDSFPRVKRRRKGGPGPGKGDRAPEPGLRGGGEGQDAAQGSRGEEPGDEAGV
VLEEKSHLEILRQFDLDLFFGPCTGITRLQRWERAEHLGLDPPQEVLKVLWAHPEDAQYQ
CSLWYLYPI
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgggccggaagaggaggctcatcaccgactccttccccagagtgaagaggaggaggaag
ggcgggccgggtcctggcaagggggacagggcgcccgagccagggctgcgaggtgggggc
gagggccaggacgcggcacagggcagcagaggggaggagccaggggatgaggccggtgta
gtcctggaggagaaaagccacttggagatactgaggcaatttgacctggacctctttttc
gggccctgtacaggtatcactcgactccaaagatgggaacgagcagagcatctgggcctg
gacccaccccaggaggtgctcaaggtgctttgggcccaccctgaagatgcccagtaccag
tgcagcctctggtacctgtaccccatctaa

DBGET integrated database retrieval system