KEGG   Monodelphis domestica (opossum): 100014886Help
Entry
100014886         CDS       T01031                                 

Definition
profilin-4-like
Orthology
K05759  
profilin
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Rap1 signaling pathway
Regulation of actin cytoskeleton
Salmonella infection
Class
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:mdo04015]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:mdo04810]
Human Diseases; Infectious diseases; Salmonella infection [PATH:mdo05132]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 129 aa AA seqDB search
MSNIQNLLLDSLLGTKHVDSAAIIKIHERTVLVCSPGFNISPNDVRVLINAFSKNPQQVR
RDGLYFREKDHVCVRADERSLYAKQNNSGLVVVQTNLYLVVATYREDMYASVCVEAVEKL
GDYLRKKGS
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacatccaaaacctcctgctcgactccctcctgggcacaaagcatgtggacagt
gctgccatcatcaagattcatgagcgtactgtcttagtgtgctcgccagggtttaatatc
tcacccaatgatgtccgggtgctcatcaatgcattctccaagaaccctcagcaagtgcga
agggatggactgtacttccgggagaaggatcatgtgtgtgtccgagccgatgagcgctcc
ctttatgccaagcagaataactcagggcttgtggtcgttcaaaccaatctctacctcgta
gtggccacctatcgggaggacatgtatgccagcgtatgtgtggaggctgtcgagaagctg
ggtgactacttaaggaaaaagggcagctaa

DBGET integrated database retrieval system