KEGG   Monodelphis domestica (opossum): 100014894Help
Entry
100014894         CDS       T01031                                 

Gene name
XRCC4
Definition
X-ray repair complementing defective repair in Chinese hamster cells 4
Orthology
K10886  
DNA-repair protein XRCC4
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    100014894 (XRCC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
3
AA seq 333 aa AA seqDB search
MERNVSRIHIVSEPSIIYFLQVSWEKDLGSGFDIILTDGQSAWSGTVTTSEISREADDMA
MERDKYVDELKKALVLGTEPANVYKFDFSKENCNFSYSRNLKNVSFILGSLILQKVSSPA
EVIRELMSYCLNCMADQLAKNEHLQRENEMLQRDWNDVQKRLEKCVTDKENLEADLHKRF
VLVLNEKKAKIRSLHKSLIQAKKSEKEKQDERESVDNAQSLNKRESVHDESSDEESENLT
VPIEVTSAGISQNDSIISNSDVIDVAPSRKKRQRLQKNIDIVPQLTPQKSSFQEKEKLEP
SPLQSSSKESISSENLSLETLKNSSPEDLFEDI
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atggagcggaatgtgagcagaatccatatagtttctgaacccagcataatttattttcta
caagtatcttgggaaaaagatctaggatctggttttgacataattcttacagatggtcag
tcagcatggagtggaacagtgactacatctgagatttccagagaagctgatgacatggca
atggaaagagacaagtatgttgatgaactgaaaaaagcattggttctgggaacagaacca
gctaatgtgtacaaatttgatttttctaaagagaactgcaatttctcctattcaagaaac
ctgaaaaatgtttcttttatacttggatcactgatcctgcagaaggtctcaagcccagct
gaagtcatccgagaactgatgagctattgcctaaactgtatggctgaccagcttgccaag
aacgaacacctgcagagagagaatgaaatgcttcagagggactggaatgatgtccaaaag
cgtcttgaaaagtgtgtgaccgacaaagaaaatctggaggcagaccttcataagcgtttt
gttctggtgctgaatgagaagaaagcaaagattagaagcttacataaatcgttaattcaa
gccaaaaaatcagaaaaggagaaacaagatgaaagggaatctgtagacaatgcccaaagc
cttaacaaaagagagtcagtccatgatgaaagcagtgatgaggaaagtgaaaatctaact
gttcctattgaagtgacttctgctggtataagccaaaacgactccattatttcaaattca
gatgtcatagatgttgcaccaagtagaaaaaagaggcagcggctgcagaaaaatattgac
atagtacctcaattgactcctcagaaatcatcttttcaagaaaaggaaaaacttgagcct
tcaccacttcagtcatcaagcaaagaatccatctcatctgaaaatctgtcactagaaacc
ttaaaaaacagtagtccagaagacctttttgaagatatatga

DBGET integrated database retrieval system