KEGG   Monodelphis domestica (opossum): 100014991Help
Entry
100014991         CDS       T01031                                 

Definition
prolactin receptor-like
Orthology
K05081  
prolactin receptor
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Cytokine-cytokine receptor interaction
Neuroactive ligand-receptor interaction
PI3K-Akt signaling pathway
Jak-STAT signaling pathway
Prolactin signaling pathway
Class
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:mdo04630]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:mdo04151]
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:mdo04080]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:mdo04060]
Organismal Systems; Endocrine system; Prolactin signaling pathway [PATH:mdo04917]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 625 aa AA seqDB search
MKENVTSTTIFLLLLFLNTNLLNGQSAPGKPKIEKCRSPEKETFTCWWKPGSDGGTAANY
TLFYRKEGESLTHECPDYKTGGPYSCYFNKKHTSIWMIYIIWVNATNQMGRSMSEPHYVD
VTYIVEPDPPLNLTLEVKQSEDRKSYLLLKWSPPALVDVRSGWLTLQYELRLKPEKAPEW
ETHFAGQQTQFKIFSLYPGQKYLVEVRCKPDHGSWSQWSPENSIVIPSDIKMKDTTVWIF
VAILSSVVCLIMVWTMALKGYSMITCLLPPVPGPKIKGFDTHLLEKGKSEELLSALGCQG
FPPTSDREDLLVEYLEVDDSEDQQLMPTYEKDHPSQGRKPTQLDPDNDSGRGSCDSPSLL
SEKCEEPRIPAPTFTIPEVNEKPDDPGTNVTHNWDPQGINFKGKNPYFNALGSKSSTWPI
PQQSSNHSLRCSYHNIADICKVALGTVNGPTVSLGKEENHALNYPTTIDTGGEETTDKQN
ELGHFHSNVDQGTTWLLPNEKMPFMSPRPMDYVEIHKVNKDGALSLLPKQKESNGNTEQA
SAPDSSKEYAKVSRVMDNNILVLMQDPRAQTRVIFEESAKESPQPLQHNQAEKNLSYCTF
PPGDCRLQTGGLDYLDPTCFIHSFN
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaaaatgtgacatcaacaactatctttcttttgcttctttttctcaacactaac
ctcctgaatggacaatcagcccctggaaaacctaagatcgaaaagtgtcgttcccctgaa
aaggaaacattcacttgctggtggaagccaggatcagatggaggaactgctgccaactac
actttattttacagaaaagaaggagagtcactcacccatgaatgtcctgactacaaaact
ggaggtccttattcctgttactttaacaagaagcacacttctatatggatgatatacatc
atctgggtcaatgccactaaccagatgggaaggagtatgtcagaaccacattatgtggat
gtgacttacatagttgaaccggaccctcctttgaacttgacattagaagtaaaacaatca
gaagatagaaaatcatatctgttgctgaaatggtctccacctgccctggttgatgttagg
tctggttggctaacacttcagtatgaattgcgactaaaacctgagaaagccccagagtgg
gagactcattttgctggacagcagacacaatttaaaatcttcagcttgtacccaggacag
aaataccttgtggaagttcgctgtaaaccagaccatggttcctggagtcagtggagccct
gaaaattcaattgtgatacccagtgacatcaaaatgaaagacacaacggtgtggatcttc
gtggctatactgtcatctgtggtttgtctgattatggtctggacgatggctctgaagggc
tacagcatgatcacctgcctcctgccacctgtcccaggccccaaaataaaaggatttgat
acccatctgctggaaaaagggaagtctgaagaactcttgagtgccctggggtgccagggt
ttccctcctacttcagaccgtgaagaccttctagtagagtatttggaagtggacgacagc
gaagaccagcagctgatgcccacctatgagaaagatcatcctagccaaggcagaaagccc
acccagcttgatccggataatgactctggcaggggaagttgtgacagtccttctcttttg
tctgagaagtgtgaagaaccccggatccctgcaccaaccttcaccattccagaggtcaat
gagaaaccagatgatcctggaacaaatgtaacccacaattgggatccccagggcataaac
ttcaaaggtaagaacccctatttcaatgctcttgggtccaaatcttcaacatggcctata
ccacagcaatccagcaaccacagcctgagatgctcttaccacaacattgccgacatttgt
aaagtggccctgggcactgtgaatggtcccactgtttcattggggaaagaagagaaccat
gctttaaattacccaacaaccattgacactggtggggaagaaacaacagacaagcagaat
gagttgggacacttccattccaacgttgaccaaggcacaacatggctgctacccaatgag
aaaatgccttttatgtctcccaggcccatggactatgtagaaattcacaaagtcaacaaa
gatggcgcattatccttgctaccaaaacagaaagaaagtaatggcaatacagaacaggct
agcgctcctgacagtagtaaagagtatgctaaggtatccagggttatggacaataacatc
ctggtgctgatgcaagacccaagagctcagaccagggtgatatttgaagaatctgctaag
gaaagtcctcagccactacaacacaaccaagctgagaaaaacctgtcctactgcaccttt
ccaccaggtgactgcagactccagactggtgggttggattacctggatccgacttgtttt
attcactcctttaattaa

DBGET integrated database retrieval system