KEGG   Monodelphis domestica (opossum): 100014991Help
Entry
100014991         CDS       T01031                                 

Gene name
PRLR
Definition
(RefSeq) prolactin receptor
  KO
K05081  prolactin receptor
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo04060  Cytokine-cytokine receptor interaction
mdo04080  Neuroactive ligand-receptor interaction
mdo04151  PI3K-Akt signaling pathway
mdo04630  Jak-STAT signaling pathway
mdo04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    100014991 (PRLR)
   04151 PI3K-Akt signaling pathway
    100014991 (PRLR)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100014991 (PRLR)
   04060 Cytokine-cytokine receptor interaction
    100014991 (PRLR)
 Organismal Systems
  Endocrine system
   04917 Prolactin signaling pathway
    100014991 (PRLR)
Cytokine receptors [BR:mdo04050]
 Interleukin receptor families
  Prolactin receptor family
   100014991 (PRLR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EpoR_lig-bind fn3 IL6Ra-bind Interfer-bind
Motif
Other DBs
NCBI-GeneID: 100014991
NCBI-ProteinID: XP_001365470
Ensembl: ENSMODG00000020376
UniProt: F7F6E0
Position
3
AA seq 636 aa AA seqDB search
MPFLLKEKEANMKENVTSTTIFLLLLFLNTNLLNGQSAPGKPKIEKCRSPEKETFTCWWK
PGSDGGTAANYTLFYRKEGESLTHECPDYKTGGPYSCYFNKKHTSIWMIYIIWVNATNQM
GRSMSEPHYVDVTYIVEPDPPLNLTLEVKQSEDRKSYLLLKWSPPALVDVRSGWLTLQYE
LRLKPEKAPEWETHFAGQQTQFKIFSLYPGQKYLVEVRCKPDHGSWSQWSPENSIVIPSD
IKMKDTTVWIFVAILSSVVCLIMVWTMALKGYSMITCLLPPVPGPKIKGFDTHLLEKGKS
EELLSALGCQGFPPTSDREDLLVEYLEVDDSEDQQLMPTYEKDHPSQGRKPTQLDPDNDS
GRGSCDSPSLLSEKCEEPRIPAPTFTIPEVNEKPDDPGTNVTHNWDPQGINFKGKNPYFN
ALGSKSSTWPIPQQSSNHSLRCSYHNIADICKVALGTVNGPTVSLGKEENHALNYPTTID
TGGEETTDKQNELGHFHSNVDQGTTWLLPNEKMPFMSPRPMDYVEIHKVNKDGALSLLPK
QKESNGNTEQASAPDSSKEYAKVSRVMDNNILVLMQDPRAQTRVIFEESAKESPQPLQHN
QAEKNLSYCTFPPGDCRLQTGGLDYLDPTCFIHSFN
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atgcctttcctgttgaaagagaaggaagcaaacatgaaggaaaatgtgacatcaacaact
atctttcttttgcttctttttctcaacactaacctcctgaatggacaatcagcccctgga
aaacctaagatcgaaaagtgtcgttcccctgaaaaggaaacattcacttgctggtggaag
ccaggatcagatggaggaactgctgccaactacactttattttacagaaaagaaggagag
tcactcacccatgaatgtcctgactacaaaactggaggtccttattcctgttactttaac
aagaagcacacttctatatggatgatatacatcatctgggtcaatgccactaaccagatg
ggaaggagtatgtcagaaccacattatgtggatgtgacttacatagttgaaccggaccct
cctttgaacttgacattagaagtaaaacaatcagaagatagaaaatcatatctgttgctg
aaatggtctccacctgccctggttgatgttaggtctggttggctaacacttcagtatgaa
ttgcgactaaaacctgagaaagccccagagtgggagactcattttgctggacagcagaca
caatttaaaatcttcagcttgtacccaggacagaaataccttgtggaagttcgctgtaaa
ccagaccatggttcctggagtcagtggagccctgaaaattcaattgtgatacccagtgac
atcaaaatgaaagacacaacggtgtggatcttcgtggctatactgtcatctgtggtttgt
ctgattatggtctggacgatggctctgaagggctacagcatgatcacctgcctcctgcca
cctgtcccaggccccaaaataaaaggatttgatacccatctgctggaaaaagggaagtct
gaagaactcttgagtgccctggggtgccagggtttccctcctacttcagaccgtgaagac
cttctagtagagtatttggaagtggacgacagcgaagaccagcagctgatgcccacctat
gagaaagatcatcctagccaaggcagaaagcccacccagcttgatccggataatgactct
ggcaggggaagttgtgacagtccttctcttttgtctgagaagtgtgaagaaccccggatc
cctgcaccaaccttcaccattccagaggtcaatgagaaaccagatgatcctggaacaaat
gtaacccacaattgggatccccagggcataaacttcaaaggtaagaacccctatttcaat
gctcttgggtccaaatcttcaacatggcctataccacagcaatccagcaaccacagcctg
agatgctcttaccacaacattgccgacatttgtaaagtggccctgggcactgtgaatggt
cccactgtttcattggggaaagaagagaaccatgctttaaattacccaacaaccattgac
actggtggggaagaaacaacagacaagcagaatgagttgggacacttccattccaacgtt
gaccaaggcacaacatggctgctacccaatgagaaaatgccttttatgtctcccaggccc
atggactatgtagaaattcacaaagtcaacaaagatggcgcattatccttgctaccaaaa
cagaaagaaagtaatggcaatacagaacaggctagcgctcctgacagtagtaaagagtat
gctaaggtatccagggttatggacaataacatcctggtgctgatgcaagacccaagagct
cagaccagggtgatatttgaagaatctgctaaggaaagtcctcagccactacaacacaac
caagctgagaaaaacctgtcctactgcacctttccaccaggtgactgcagactccagact
ggtgggttggattacctggatccgacttgttttattcactcctttaattaa

DBGET integrated database retrieval system