KEGG   Monodelphis domestica (opossum): 100014995Help
Entry
100014995         CDS       T01031                                 

Gene name
FLNC
Definition
(RefSeq) filamin C, gamma
  KO
K04437  
filamin
Organism
mdo  Monodelphis domestica (opossum)
Pathway
MAPK signaling pathway
Focal adhesion
Salmonella infection
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100014995 (FLNC)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    100014995 (FLNC)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    100014995 (FLNC)
  Infectious diseases
   05132 Salmonella infection
    100014995 (FLNC)
Exosome [BR:mdo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100014995 (FLNC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
8
AA seq 2707 aa AA seqDB search
MMNNSSYPEGLGEEMEEMPSTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVGKRLGDLQKD
LSDGLRLIALLEVLSQKRMYRKFHPRPNFRQMKLENVSVALEFLEREHIKLVSIDSKAIV
DGNLKLILGLIWTLILHYSISMPMWEDEDDEDARKQTPKQRLLGWIQNKVPQLPITNFNR
DWQDGKALGALVDNCAPGLCPNWEAWDPSQPVENAREAMQQADDWLGVPQVIAPEEIVDP
NVDEHSVMTYLSQFPKAKLKPGAPVRSKQLNPKKATAYGPGIEPHGNTVLQPAHFTVQTV
DAGLGEVLVYIEDPEGHTEEAKVVPNNDKDRTYAVSYVPKVAGLHKVTVLFAGQNIERSP
FEVNVGMALGDANKVSARGPXLEPVGNVANKPTXIALSTTGAGNGDVSVVIVDPQGRRDT
VEVALEDKGDSTFRCTYRPVLEGPHTVHVAFAGSPISRSPFPVHVAEACNPNACRAAGRG
LQPKGVRVKEVADFKVFTKGAGSGELKVTVKGPKGTEEPVKVREAGDGMFECEYYPAVPG
KYVVTITWGGYAIPRSRAWGPGLETGQVFKSADFVVEAIGTEVGTLGFSIEGPSQAKIEC
DDKGDGSCDVRYWPTEPGEYAVHVICDDEDIRDSPFIAHIQPAPPDCFPDKVKAFGPGLE
PTGCIVDKPAEFTIDARAAGKGDLKLYAQDAEGCPIDIKVVPNGDGTFRCSYVPTKPIKH
TIIVTWGGVNVPKSPFRVNVGEGSHPEKVRVYGPGVEKTGLKANEPTYFTVDCSEAGQGD
VSIGIKCAPGVVGPAEADIDFDIIKNDNDTFTVKYTPPGAGHYTIMVLFANQEIPASPFH
IKVDPSHDASKVRAEGPGLSRTGVEVGKPTHFTVLTKGAGKAKLDVHFAGAAKGEAVRDF
EIIDNHDYSYTVKYTAVQQGNMAVTVTYGGDPVPKSPFVVNVAPPLDLSKVKVQGLNSKV
AVGQEQAFSVSTRGAGGQGQLDVRMTSPSRRPIPCKLEPGGGAEAQAVRYMPPEEGPYKV
DITYDGHPVPGSPFAVEGVLPPDPSKVCAYGPGLKGGLVGTPAPFSIDTKGAGTGGLGLT
VEGPCEAKIECQDNGDGSCAVSYLPTEPGEYTINILFAEAHIPGSPFKADIRPVFDPSKV
RASGPGLERGKAGEAATFTVDCSEAGEAELTIEILSDAGVKAEVLIHNNADGTYHITYKP
AFPGTYTITIKYGGHPVPKFPSRVHVQPAVDTSGIKVSGPGVEPHGVLREVTTEFTVDAR
SLTATGGNHVTARVLNPSGAKTDTYVTDNGDGTYRVQYTAYEEGIHLVEVLYDDVAVPKS
PFRVGVTEGCDPSRVRAYGPGLEGGLVNKANRFTVETRGAGTGGLGLAIEGPSEAKMSCK
DNKDGSCSVEYIPFTPGDYDVNITFGGRPIPGSPFRVPVKDVVDPGKVKCSGPGLGAGVR
ARVPQTFTVDCSQAGRAPLQVAVVGPTGVAEPVEVRDKGDGTHTVNYTPATDGPYTVAVK
YADQEVPRSPFKIKVLPAHDASKVRASGPGLNASGIPASLPVEFTIDARDAGEGLLTVQI
LDPEGKPKKANIRDNGDGTYTVSYLPDMSGRYTITIKYGGDEIPYSPFRIHALPTGDASK
CLVTVSIGGHGLGACLGPRIQIGEETVITVDAKAAGKGKVTCTVSTPDGAELDVDVVENH
DGTFDIYYTAPEPGKYVITIRFGGEHIPNSPFHVLACDPIPHVEEPCDTLQLHQPFPTHR
PSSYPTHWATDEPVVPAEPMESMLRPFNLVIPFTVQKGEITGEVRMPSGKTARPNITDNK
DGTITVRYAPSEKGLHEMGIKYDGNHIPGSPLQFYVDAINSRHVSAYGPGLSHGMVNKPA
TFTIVTKDAGEGGLSLAVEGPSKAEITCKDNKDGTCTVSYLPTAPGDYSIIVRFDDKHIP
GSPFTAKITGDDSMRTSQLNVGTSTDVSLKITESDLSLLTASIRAPSGNEEPCLLKRLPN
RHIGISFTPKEVGEHVVSVRKSGKHVTNSPFKILVGPSEIGDASKVRVWGKGLSEGHTFQ
VAEFIVDTRNAGYGGLGLSIEGPSKVDINCEDMEDGTCKVTYCPTEPGNYTINIKFADKH
VPGSPFTVKVTGEGRMKESITRRRQAASIASVGSTCDLNLKIPGNWFQMVSAQERLTRTF
TRSSHTYTRTERTEISKTRGGETKREVRVEESTQVGGDPFPAVFGDFLGRERLGSFGSIS
RQQEGEAGSQDMTAQVTSPSGKTEEAEILEGENSAYSVRFVPKEMGPHTVTVKYRGQHVP
GSPFQFTVGPLGEGGAHKVRAGGTGLERGVAGVPAEFSIWTREAGAGGLSIAVEGPSKAE
IAFEDRKDGSCGVSYIVQEPGDYEVSIKFNDEHIPDSPFVVPVASLSDDARRLTVTSLQE
TGLKVNQPASFAVQLNGARGVIDARVHTPSGAVEECYVSELDSDKHTIRFIPHENGVHSI
DVKFNGSHIPGSPFKIRVGEQSQAGDPGLVSAYGPGLEGGTTGVSSEFIVNTLNAGSGAL
SVTIDGPSKVQLDCRECPEGHVVTYTPMAPGNYLIAIKYGGPQHIVGSPFKAKVTGPRLS
GGHSLHETSTVLVETVTKSSSSRGSSYSSIPKFSSDASKVVTRGPGLTKAFIGQKNSFTV
DCSKAGTNMMMVGVHGPKTPCEEVYVKHMGNRVYNVTYTVKEKGDYILIVKWGDESVPGS
PFKVNVP
NT seq 8124 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacaacagcagctaccccgagggcctcggcgaggagatggaggagatgccctcc
acagagaaggacctggccgaggacgcaccgtggaagaagattcagcagaacacgttcact
cgctggtgcaacgagcacctcaagtgcgtgggcaagcgcctgggggacctccagaaggac
ctgagcgacggcctgcgcctcatcgctctgctcgaggtgctgagccagaagcgcatgtac
cgcaagttccacccgcggcccaactttcgccagatgaagctcgaaaacgtgtccgtggcg
ctcgagttcttggagcgcgaacacatcaagctagtgtccatcgatagtaaggccattgtg
gatgggaacttgaagctgatcctgggtcttatctggaccctgatcctgcactactccatc
tccatgcccatgtgggaggatgaagatgatgaagatgctcgaaaacagacccccaagcag
cggttacttggctggattcagaataaggtgcctcagctgcccatcaccaacttcaacaga
gactggcaggatggcaaggccctcggggctctggtggacaactgtgcccctggcctgtgt
cccaactgggaggcgtgggatcccagccagccagtggagaatgcccgagaggccatgcag
caggccgatgactggctaggtgtgccgcaggtgattgcccctgaggagattgtggacccc
aatgtggatgagcactccgtcatgacgtacctgtcccaattccccaaagccaagctcaag
cctggagcccctgttcgatccaagcagctgaaccccaagaaggccacagcctacgggcct
ggcatcgagcctcacgggaacaccgtgcttcagccagcccactttaccgtacagacagtg
gatgcggggctgggggaggtcctggtgtacatcgaggaccccgagggccacaccgaagag
gccaaagtggttcccaacaacgacaaggaccggacctacgctgtttcctacgtgcccaag
gtggccgggctgcacaaggtgacggtgctcttcgccggccagaacatcgagcgcagcccc
tttgaggtgaacgtgggcatggccctgggggatgctaacaaggtgtcagctcgaggaccg
ngcctggagccggtgggcaacgtggccaacaagcccacnnatatcgcgctttccacaaca
ggggcaggaaacggcgacgtttctgtggtgattgttgaccctcagggccggcgagacacc
gtggaggtggcgttggaggacaagggggacagcaccttccgctgcacctacaggcctgtg
ctggaggggccccacacggtgcacgtggccttcgccggctcccccatcagccgaagccct
ttccctgttcatgtggctgaagcttgcaatcccaacgcctgccgggcagcgggccggggc
ctccagcccaagggtgtccgagtcaaggaggtcgctgatttcaaggtgttcaccaagggt
gcaggcagtggagagctcaaagtcaccgtgaaagggccaaagggcacggaggagccagtg
aaagttcgagaggcaggtgatggcatgtttgaatgtgaatactatcccgcagtacctgga
aaatatgtggtcaccatcacatggggtggctatgccatcccacgcagtcgggcctggggc
cctggcctagagacaggccaagttttcaagtcagctgactttgtggtagaagccatcggc
acagaggtgggcacactggggttctccatcgagggcccatcacaggccaagattgaatgt
gatgacaagggcgatggctcctgtgacgtgcgctactggcctacagagccaggagagtac
gccgtccacgtcatctgtgatgacgaagatatccgtgattcccccttcattgcccacatt
cagcccgccccgccagactgtttcccagacaaggtgaaggcctttgggccggggctggaa
cccacaggctgcatcgtggacaaaccagcagagttcaccattgatgcccgagccgctggc
aagggtgacctcaagctctatgcccaggatgccgaagggtgccccattgatatcaaggtg
gttcccaatggagatggcactttccggtgctcctatgtgcccaccaagcccatcaagcac
accatcattgtcacctggggaggggtcaatgttcccaagagtcccttccgggtaaatgtc
ggggagggcagtcaccctgagaaggtgagagtgtacggcccaggagtggagaagactggc
ctcaaggctaatgaaccaacctactttactgtggactgcagcgaagctggacaaggggat
gtgagcatcggcattaagtgtgctcccggtgtggtgggtcctgcggaagctgacatcgat
tttgatatcataaagaacgacaacgataccttcactgtcaagtacaccccccctggggct
ggccactacaccatcatggtgctgtttgctaaccaggaaatcccagccagccccttccac
atcaaagtggacccgtcccacgatgcaagcaaggtccgagccgaaggtcctgggctcagc
cgcactggtgtggaggttgggaagccgacacactttacggtgctgaccaagggtgccggg
aaggccaagctggatgttcactttgccggagcagcgaagggggaggctgtccgggatttt
gagatcatcgacaaccatgactattcctacacagtcaaatacacagccgtccagcagggt
aacatggcagttaccgtgacctacggcggggatcctgtccctaaaagccccttcgtggtg
aatgtggcaccccctctggacctcagcaaggtcaaagttcaaggccttaatagcaaggtg
gccgtgggacaggagcaggcattctcggtgagcactcggggtgcaggtggccagggacag
ttagatgtacggatgacttcaccttcccgccggcccatcccctgcaagctggagccagga
ggtggagctgaggcgcaggctgtccgatacatgccacccgaggaggggccctacaaggtg
gacatcacctatgacggacacccagtgcctggcagcccctttgctgttgagggtgtcttg
ccccctgatccctccaaggtgtgcgcctacggtcccggactcaagggcggcttggtgggt
acaccagcaccattttccatcgacaccaagggtgcaggaacagggggcctggggctgaca
gtggagggtccctgcgaggccaagatcgaatgccaagataacggagatggctcttgtgca
gtgagctacctgcccacagagccgggcgagtacaccatcaacatcctctttgctgaggct
cacattcccggctcacccttcaaggcggatatccgaccggtctttgatcctagcaaggtt
cgggctagtggcccagggctcgagcgagggaaggccggtgaggcggccaccttcacggtg
gactgctcagaagcaggagaggctgagctgaccattgagatcttgtccgatgccggagtt
aaagccgaggtgctgatccacaacaatgccgatggcacctaccacatcacctataagcca
gctttccccggcacctacaccattaccatcaaatatggaggacaccccgtgcccaaattc
ccttcccgggtccacgtccagcccgcggttgatacgagcggcatcaaggtctccggccct
ggtgtggagccccatggtgttctccgagaagtgaccacagagttcacagtggatgctcga
tccctgactgctacgggcggcaaccacgtgacagcccgagtgcttaatccctccggagct
aagacagacacctacgtgacagacaatggggatggcacctaccgggtgcagtacacggcc
tacgaggagggcatccacttggtagaggtgttatatgacgacgtggctgttcccaagagt
ccattccgagtcggcgtgactgaaggctgtgacccttcccgggttcgggcctatgggcct
ggcctggagggaggcctggtcaacaaagctaaccgcttcacggtagagacaaggggagcc
ggcactgggggcctgggcctggctatcgagggtccctctgaggcaaagatgtcctgcaag
gacaacaaggatggcagctgcagtgtggagtacatccccttcacccctggagactacgac
gtgaacatcacctttggagggcgacctatcccagggagcccgttccgagtgccggtgaag
gatgtggtggatcctggaaaggtgaagtgttcgggccctgggctgggagctggtgtcaga
gccagagtcccccagaccttcactgtagattgcagtcaagctggacgagccccattgcaa
gtggcagtggtgggacccacaggagtggctgaaccagtagaggtgcgagacaagggagac
ggcacccacaccgtgaactatactccagccaccgatgggccatacactgtggctgtcaag
tatgctgaccaagaggtgccacgcagccccttcaagatcaaggtgctgccagctcacgat
gccagcaaggtacgcgcaagtggtcccgggctcaatgcttcgggcatcccagccagcctt
ccagtggagttcaccatcgatgccagagatgccggagaggggctgcttacggtccagatt
ctggaccctgagggcaaacctaagaaggcaaatatccgggacaatggagacggcacatac
accgtgtcctacctgccagatatgagtggccgatacaccatcaccatcaagtacgggggt
gatgagatcccctactcgcccttccgaatccatgctttgccaactggggatgccagcaag
tgccttgtcactgtgtccatcggtggtcatggccttggtgcatgtctgggcccccgaatc
cagatcggcgaagagacggtgatcacggtggatgccaaggcagcaggaaagggcaaggtg
acgtgcacggtgtctaccccagatggggcagaactggatgtggatgtcgtagaaaaccac
gacggcaccttcgacatctactatacggcccctgagccgggcaagtacgtcatcaccatc
cgctttggaggagagcacatccccaacagtcccttccacgttctggcgtgtgaccccatt
ccccatgtggaggagccgtgtgacaccctacagctgcaccagcccttccctacacaccgg
cccagtagctaccccacccattgggccacagatgaaccggtggtcccagcagagcccatg
gagtccatgttgagacccttcaacttggttatcccattcacagtccagaagggggagatc
acaggtgaggtgcggatgccctcagggaagactgcaaggcccaatatcacagataataag
gacggcaccatcacagtgaggtatgcgcccagtgagaagggactccatgagatggggatc
aaatacgacggcaatcacatccccgggagccccctgcagttctatgttgatgccatcaat
agccgccatgtaagtgcctatgggccaggcttgagccacggcatggtcaacaagccagcc
accttcacaattgtcaccaaggatgctggggaagggggcctgtctcttgctgtggagggc
ccgtctaaggcagagatcacctgtaaagacaataaagatggcacctgtacggtatcttac
ctccctactgctcccggggactatagcatcatagtccgttttgatgacaagcacatccct
gggagtcccttcactgccaagatcacaggcgatgactcaatgcggacttcacagctgaat
gtgggcacgtccacggatgtgtcactgaagatcacagagagtgacctgagcctgctgact
gccagcatccgggctccctcaggcaatgaggagccctgtctgctcaagaggcttccgaac
cggcacatcggtatctcgttcacccccaaggaggtgggtgagcacgtagtgagtgtccga
aagagtgggaagcatgtcaccaacagccccttcaagattctcgtggggccttctgagatc
ggtgatgccagcaaggttcgggtgtggggcaaaggactgtcagagggccacaccttccag
gtggcagaattcattgtggatacaagaaacgcagggtatgggggtctggggctgagcatt
gaaggtcccagcaaggtggacatcaactgtgaggacatggaagatggtacctgcaaggtg
acctactgccccactgagcctggcaactacaccatcaacatcaagtttgcagataagcat
gtgcctgggagcccattcactgtgaaggtgactggtgaggggcggatgaaggagagcatc
actcggcgcaggcaggcggcctccattgcctctgtaggaagcacctgtgacctcaacctc
aagatcccaggaaactggttccagatggtttctgcccaggagcgcctgaccaggacattc
acaaggagtagtcatacgtatacacggacagagaggacagagatcagcaaaactcggggt
ggggaaaccaagcgagaggtcagggtggaagagtccacccaagttgggggagaccccttc
cctgctgtctttggagatttcctgggtcgagagcgccttggctcttttggcagtattagc
agacaacaggaaggcgaggcaggctctcaggacatgaccgcccaggtgactagcccttcg
gggaagacggaagaagccgagatcctggagggagagaatagtgcttacagtgtgcgcttt
gtgcccaaagagatggggcctcacacggtcacggtcaagtaccgaggccagcatgttccc
ggcagccccttccagttcaccgtggggccccttggtgaagggggtgcccataaggttcga
gctgggggcacaggacttgagcgcggcgttgctggagtgccagccgaattcagcatctgg
acccgggaggcaggtgccggaggcctgtctatcgctgtggaggggcccagcaaggctgag
attgcatttgaggaccgtaaagatggttcctgcggcgtctcctatatcgtccaggagcca
ggtgactatgaggtctccatcaagttcaatgatgagcacatccccgacagccccttcgtg
gttcctgtggcctccctctccgacgatgcccggcgcctcaccgttacaagcctccaggag
actgggctgaaggtgaatcagccagcttcctttgcagtccagctgaatggtgcccgcggc
gtgattgatgccagggtccacaccccctcaggggcagtggaggagtgttatgtctctgag
ctagacagtgacaagcacaccatccgcttcatccctcacgagaatggagtccattctata
gatgtcaagttcaatggttctcacatccctgggagtcccttcaagattcgagttggagag
caaagccaagctggggatccaggcctggtctcagcctatggccctgggcttgaaggaggc
actactggtgtatcctctgagttcattgtgaacaccttgaatgcaggctcaggggcctta
tcggtcaccattgatggcccctccaaggtgcaactggactgtcgagaatgcccagaaggt
catgtggtcacctatacccctatggccccaggcaactacctcattgccatcaaatatggt
ggcccccagcacattgtgggcagccccttcaaggctaaggttacagggcctcggctgtca
ggaggccatagtcttcatgaaacctccacagtgctggtggagacagtgaccaagtcatcc
tccagccgtggttccagctacagctccatccccaagttctcctcagatgctagcaaggtg
gtgaccaggggccctgggctgaccaaggccttcataggccagaagaactccttcacagtg
gactgtagcaaagcaggcactaacatgatgatggtgggtgtgcatgggcccaagactccc
tgtgaggaagtatatgtgaagcacatgggaaaccgagtgtacaacgtcacctacactgtc
aaggaaaagggagactacatcctcattgtcaagtggggagatgaaagtgtcccaggcagt
cccttcaaggtcaatgtgccctga

DBGET integrated database retrieval system