KEGG   Monodelphis domestica (opossum): 100015746Help
Entry
100015746         CDS       T01031                                 

Gene name
ALOX12
Definition
arachidonate 12-lipoxygenase
Orthology
K00458  
arachidonate 12-lipoxygenase [EC:1.13.11.31]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Arachidonic acid metabolism
Metabolic pathways
Serotonergic synapse
Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    100015746 (ALOX12)
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    100015746 (ALOX12)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100015746 (ALOX12)
Enzymes [BR:mdo01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.31  arachidonate 12-lipoxygenase
     100015746 (ALOX12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 666 aa AA seqDB search
MGRYRVRVATGSFAFSGSTNQVQLWLVGQRAEAELGLQLRPTRGQMEDFEVDVSEDLGPL
RFVKLRKIHLLLKDAWFCNHITVWVSEKSMEEAKEIVFPCYKWVQGDAIICLPEATAWMM
GNDVQDLFQKHREEELEERRRLYRWATWKKGLPLSIDATSEKDLPLDVRFHENKKSDFEG
TLIAGMMKIILKRIYTLLNSWNSLEDFDQIFWFSKSTLAKKVRQSWKDDDFFGYQFLNGV
NPTLLRRSTSLPNRLVIPKEAEGLQVQLERKLQEGCLFEADFSLLDGIQPNVIQGKKQYL
AAPLVMFKMEPDGKLLPMVIQLQPPCSSSPVPPLFLPSDPSLTWLLAKAWVKNSDFQLHE
LQAHLLKTHLMAEVFAVATMRCLSGMHPIFKLLIPHLRYTLEINTRARTKLISDGGIFDQ
VVNTGGGGHLEVLRRATACLTYRSLCPPDDLADRGLLGIPSALYVHDALRLWDIISRYVN
GIVHLHYSGDKVVQSDLELQSWCSEITEIGLCGAQDRGFPVSFQSRADLCHFLTMCIFTC
TVQHTGINQGQIDWYAWVPNAPCTMRQPPPTTKDVTLEMVMATLPNVQQACLQMTIAWHL
GRFQPDMVPLGQHKEEYFSGSGPKAVLSHFLEELDTLEKEIVARNKNLDLPYEYLQPSRI
ENSITI
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgggtcggtacagagtacgtgtggccactggaagctttgccttctcagggtctaccaac
caagtgcagctgtggttggttgggcagcgtgcagaggcggaactggggctgcagctgcgg
cccactcgaggacagatggaggattttgaagtagatgtctcagaagacctggggcccctc
cggtttgtgaagctccggaaaatccacctcctgctgaaggatgcctggttctgcaaccac
ataactgtttgggtctctgagaagagcatggaggaggcgaaggagatagtattcccttgc
tacaaatgggtgcagggagatgccatcatctgcctgcctgaggctactgcttggatgatg
ggaaatgatgtccaagacctgtttcagaaacacagagaagaggagctggaggagagaagg
agattatatcgctgggccacctggaagaaagggctaccattgtcaattgatgcaacatca
gagaaagacctacctctggatgtgagattccatgagaataagaagtctgactttgaagga
acactgattgcaggaatgatgaagattatccttaaacgcatatacactcttctcaattcc
tggaatagcttagaagattttgaccaaatcttctggttcagcaagagtactctggctaag
aaggtgcgccagtcctggaaggatgatgatttttttggctaccagttcctcaatggagtc
aacccaacactgctgagaaggtctacctcacttcccaacagacttgtgatccccaaagag
gcagaggggcttcaggttcagctggaaagaaagctccaggagggctgcctgtttgaagct
gatttttccctgttggatggaatccaacccaatgtgatccaggggaagaaacagtaccta
gctgcccccctagttatgtttaagatggagcctgatgggaagctgctacccatggtcatc
cagctccagcctccctgctctagctctccagttccaccactcttcctgccctcagatccc
tccctcacttggctcctagccaaagcctgggtcaaaaattctgacttccaactgcatgaa
ctgcaagcacatctgctgaagacccatttgatggctgaagtgtttgctgtagccaccatg
aggtgcctctcagggatgcaccccatcttcaagctcctgattcctcacctccgatatact
ctggagattaacactcgtgcccggaccaaactcatttctgatggggggatttttgatcag
gtggtgaacactggtgggggaggtcacctggaagtcctccgcagggcaacagcctgtctg
acctatcgatccctctgccctcctgatgatctggctgacagagggcttctgggaattcca
tcagctctctatgtccatgatgccctcaggctatgggacattatctcccgatatgtgaat
ggaatagtccatctacattattcaggggacaaggttgttcagagtgatcttgagctacag
tcctggtgcagtgagatcactgagattgggttatgtggagcccaggaccgaggatttcct
gtctccttccagtccagggctgacctctgccactttctcaccatgtgcatcttcacatgc
acagtccaacacacaggcattaatcagggacagatagactggtatgcctgggttcctaat
gctccatgcactatgcggcaacccccaccaactacaaaggatgtaacattggagatggtg
atggccacactgcccaatgtccaacaggcctgcctccagatgactattgcatggcacttg
ggtcggttccagccagacatggtacccctgggtcagcataaggaagaatacttttcagga
tctgggcccaaggctgtgctgagtcatttcctggaagaattagacactctagaaaaagag
attgtggcccgtaataagaatctagacctgccctatgagtacctgcagcccagcagaata
gagaacagcattaccatttaa

DBGET integrated database retrieval system