KEGG   Monodelphis domestica (opossum): 100015820Help
Entry
100015820         CDS       T01031                                 

Definition
alcohol dehydrogenase class 4 mu/sigma chain-like
Orthology
K13951  
alcohol dehydrogenase 1/7 [EC:1.1.1.1]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Metabolic pathways
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100015820
  Lipid metabolism
   00071 Fatty acid degradation
    100015820
  Amino acid metabolism
   00350 Tyrosine metabolism
    100015820
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100015820
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100015820
   00982 Drug metabolism - cytochrome P450
    100015820
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100015820
Enzymes [BR:mdo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     100015820
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
5
AA seq 376 aa AA seqDB search
MNTSGKVIKCKAAVLWGLEQPFSIEEIEVAPPKAHEVRIKILATGICRTDNNATTGVMPA
KFPVIVGHEAVGIVESIGEGVTSLKPGDKVIPLCVPQCGICSNCLKPDSNYCDMLDIVGK
GVLSDGTSRFTCKGKPVYHYMNTSTFTEYTVVRDVAVAKIDAAAPPEKACLFGCAFTTGY
GAAINTAKVTPGSTCAVFGLGGVGLSVIIGCKIAGASRIIGVDINPRKFEKAKAVGATEC
VNPKDHTKPISEVLKEMTGDSVRYTFEVTGNLDTMIDALASCHKNCGMSVVVGDPPASSV
LTFDPMLVFDGRTWKGCIFGGWKPVNDLPKLVSDFMAKKFNLDELVTHILPFDKIEEGFN
LLKKGESIRTVLTFQH
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgaacacttcaggaaaagtgattaaatgcaaagctgctgtgttatggggcctggagcaa
cccttttccatcgaggaaattgaagttgccccaccaaaagctcatgaagttcgaattaag
atcttggccacaggcatatgtcgcacagataataatgcaaccactggagtcatgcctgct
aaatttccagtcattgtgggacatgaagcagttggaattgtagaaagtattggcgaagga
gtaacatcattgaaaccaggagacaaggttatcccactttgtgtcccacagtgtggaatt
tgctctaattgcttgaaacctgattcaaattactgtgacatgcttgatatcgttggtaaa
ggagtattgtctgatggcacgagcagatttacctgcaaagggaagccagtctaccactac
atgaacaccagtaccttcactgaatacacagtggtgagggatgttgcagttgcaaaaatt
gatgctgccgctcctcctgagaaggcttgcttgtttggctgtgcattcactactggctat
ggggctgcaatcaacactgccaaggttacccctggatctacatgtgctgtctttgggctg
ggaggagttggtctctcagttattataggctgtaaaattgctggtgcttcccggatcatt
ggagttgacatcaatccacgcaaatttgagaaggccaaggctgtaggagccactgagtgt
gtcaaccctaaggaccacacaaagcccattagtgaagtgctaaaggaaatgactggtgat
tctgtgcggtatacctttgaggttactggaaaccttgatacaatgattgatgccctggct
tcctgccataagaactgtggaatgagtgtggtagtaggcgatcctccagcatcttcagtg
ctcacctttgatcccatgttggtgttcgatggacgcacctggaaaggatgtatttttggt
ggttggaaacccgtaaatgatctccccaaactagtgtctgacttcatggcaaagaaattt
aacttggatgaattagttacccatattttaccttttgataaaattgaagaaggcttcaat
ctacttaaaaaaggagaaagtattcgaacagtcctgacgtttcaacactga

DBGET integrated database retrieval system