KEGG   Monodelphis domestica (opossum): 100015828Help
Entry
100015828         CDS       T01031                                 

Definition
(RefSeq) cytochrome P450 2E1
  KO
K07415  cytochrome P450 family 2 subfamily E polypeptide 1 [EC:1.14.13.-]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo00140  Steroid hormone biosynthesis
mdo00590  Arachidonic acid metabolism
mdo00591  Linoleic acid metabolism
mdo00980  Metabolism of xenobiotics by cytochrome P450
mdo00982  Drug metabolism - cytochrome P450
mdo00983  Drug metabolism - other enzymes
mdo01100  Metabolic pathways
mdo04932  Non-alcoholic fatty liver disease (NAFLD)
mdo05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100015828
   00590 Arachidonic acid metabolism
    100015828
   00591 Linoleic acid metabolism
    100015828
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100015828
   00982 Drug metabolism - cytochrome P450
    100015828
   00983 Drug metabolism - other enzymes
    100015828
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100015828
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100015828
Enzymes [BR:mdo01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.-  
     100015828
Cytochrome P450 [BR:mdo00199]
 Cytochrome P450, animal type
  CYP2 family
   100015828
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 100015828
NCBI-ProteinID: XP_001364901
Ensembl: ENSMODG00000010247
UniProt: F6W669
Position
1
AA seq 493 aa AA seqDB search
MAFLGATLALLVWFVFLLFVSVWKQIQSSWKLPPGPFPLPIIGNLFTLDIRNFPKSFAKL
AKEYGPVFTVYVGSRRIVVLHGYKVVKEALLDLKNEFAGRADIPAFEAHQNSGIIFNDSE
TWRDTRRFGLTVLRDYGMGKQSNEERIQRESHFLVEALRNTNSQPFDPTFVLGGGPLNVI
HDILFHSRLDYSDKMCQRLLHLYNEDFYLLSSPWIQVYNNIGSYLRYLPGSHRKLLKNIS
EAKQYVFEKVKEHQEVVDLNHPYDLTDTLLIQMEKDQKKKKLGFNLENVTVTVADLLFAG
TETTSTTLRYGLLLLLKHPKVEEKLHEEIDRVIGPHRLPSMKDKINMPYMEAVVHEIQRV
INLVPSNLPHVMHEDIHFRGYLLPKGTTVYPTLDSVMLDSEEFPNPEQFDPGHFLNENGK
FRYSDYFKAFSAGKRVCVGEGLARMEIFLFLTIILQHFNLKPLISPEKIDTSPLTVGFGT
IPPIYKLCVLPRS
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggcttttctgggcgctactctcgctttgttagtttggttcgttttcctactctttgtc
tcagtatggaagcagattcagagcagttggaaacttcctccaggcccatttcctcttcca
ataattggaaatcttttcaccttggacattaggaatttcccaaaatcttttgccaagcta
gctaaagaatatggccctgtgttcactgtgtatgttggctcaaggcgtattgtggtgtta
catggatataaagttgtaaaggaagctttgctggaccttaaaaatgagtttgcaggaaga
gcagatataccagcctttgaggcccatcagaattctggaattattttcaatgattcagag
acctggagagatacacgtcgatttggcctcacagtcctcagagattatggaatgggaaag
cagagcaatgaagaaagaattcagagggaatctcacttcctggttgaggcactcaggaac
acaaattctcaaccctttgatccaaccttcgtccttggtggtggtcccttaaatgtcatc
catgacattctattccacagtcgccttgactattcagacaagatgtgtcaaaggctattg
catctgtacaatgaagacttctacctgttaagctcaccctggatccaggtttacaataat
ataggatcttacttgcgttacctacctggaagtcaccggaaacttttgaaaaatatatct
gaagcaaagcagtatgtatttgaaaaagtcaaagaacaccaagaggtagtggatcttaat
cacccttatgatttaactgacactctactcatccaaatggagaaggaccaaaagaagaaa
aaacttggatttaacctagaaaatgtaacagtcactgtggccgatttactttttgctgga
acagagactaccagcaccactttgagatatggattacttctacttctaaaacaccccaaa
gtggaagaaaaactccatgaagaaattgatcgagtgattggaccacaccgacttccttcc
atgaaggacaaaataaacatgccttacatggaggctgtggtacatgagatccagagagtc
attaacctcgtcccttctaacctgccccacgtaatgcatgaagacatccatttcagagga
tatctactacccaagggcacaacagtatacccaacactagactctgtcatgctggacagt
gaagaattccctaatccagaacaatttgacccaggacattttctgaatgaaaatgggaaa
tttagatacagtgactacttcaaagctttttctgcaggaaaacgtgtatgtgttggagaa
ggtctggctcgaatggaaatatttttattcctgaccataattttacagcattttaatttg
aagcctctcatcagtccagaaaaaattgacaccagcccactcactgttggttttggcacc
atcccaccaatttataagctttgcgttctgcctcgatcatag

DBGET integrated database retrieval system