KEGG   Monodelphis domestica (opossum): 100015828Help
Entry
100015828         CDS       T01031                                 

Definition
cytochrome P450 2E1-like
Orthology
K07415  
cytochrome P450, family 2, subfamily E, polypeptide 1 [EC:1.14.13.-]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Steroid hormone biosynthesis
Arachidonic acid metabolism
Linoleic acid metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Metabolic pathways
Non-alcoholic fatty liver disease (NAFLD)
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100015828
   00590 Arachidonic acid metabolism
    100015828
   00591 Linoleic acid metabolism
    100015828
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100015828
   00982 Drug metabolism - cytochrome P450
    100015828
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100015828
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100015828
Enzymes [BR:mdo01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.-  
     100015828
Cytochrome P450 [BR:mdo00199]
 Cytochrome P450, animal type
  CYP2 family
   100015828
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 493 aa AA seqDB search
MAFLGATLALLVWFVFLLFVSVWKQIQSSWKLPPGPFPLPIIGNLFTLDIRNFPKSFAKL
AKEYGPVFTVYVGSRRIVVLHGYKVVKEALLDLKNEFAGRADIPAFEAHQNSGIIFNDSE
TWRDTRRFGLTVLRDYGMGKQSNEERIQRESHFLVEALRNTNSQPFDPTFVLGGGPLNVI
HDILFHSRLDYSDKMCQRLLHLYNEDFYLLSSPWIQVYNNIGSYLRYLPGSHRKLLKNIS
EAKQYVFEKVKEHQEVVDLNHPYDLTDTLLIQMEKDQKKKKLGFNLENVTVTVADLLFAG
TETTSTTLRYGLLLLLKHPKVEEKLHEEIDRVIGPHRLPSMKDKINMPYMEAVVHEIQRV
INLVPSNLPHVMHEDIHFRGYLLPKGTTVYPTLDSVMLDSEEFPNPEQFDPGHFLNENGK
FRYSDYFKAFSAGKRVCVGEGLARMEIFLFLTIILQHFNLKPLISPEKIDTSPLTVGFGT
IPPIYKLCVLPRS
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggcttttctgggcgctactctcgctttgttagtttggttcgttttcctactctttgtc
tcagtatggaagcagattcagagcagttggaaacttcctccaggcccatttcctcttcca
ataattggaaatcttttcaccttggacattaggaatttcccaaaatcttttgccaagcta
gctaaagaatatggccctgtgttcactgtgtatgttggctcaaggcgtattgtggtgtta
catggatataaagttgtaaaggaagctttgctggaccttaaaaatgagtttgcaggaaga
gcagatataccagcctttgaggcccatcagaattctggaattattttcaatgattcagag
acctggagagatacacgtcgatttggcctcacagtcctcagagattatggaatgggaaag
cagagcaatgaagaaagaattcagagggaatctcacttcctggttgaggcactcaggaac
acaaattctcaaccctttgatccaaccttcgtccttggtggtggtcccttaaatgtcatc
catgacattctattccacagtcgccttgactattcagacaagatgtgtcaaaggctattg
catctgtacaatgaagacttctacctgttaagctcaccctggatccaggtttacaataat
ataggatcttacttgcgttacctacctggaagtcaccggaaacttttgaaaaatatatct
gaagcaaagcagtatgtatttgaaaaagtcaaagaacaccaagaggtagtggatcttaat
cacccttatgatttaactgacactctactcatccaaatggagaaggaccaaaagaagaaa
aaacttggatttaacctagaaaatgtaacagtcactgtggccgatttactttttgctgga
acagagactaccagcaccactttgagatatggattacttctacttctaaaacaccccaaa
gtggaagaaaaactccatgaagaaattgatcgagtgattggaccacaccgacttccttcc
atgaaggacaaaataaacatgccttacatggaggctgtggtacatgagatccagagagtc
attaacctcgtcccttctaacctgccccacgtaatgcatgaagacatccatttcagagga
tatctactacccaagggcacaacagtatacccaacactagactctgtcatgctggacagt
gaagaattccctaatccagaacaatttgacccaggacattttctgaatgaaaatgggaaa
tttagatacagtgactacttcaaagctttttctgcaggaaaacgtgtatgtgttggagaa
ggtctggctcgaatggaaatatttttattcctgaccataattttacagcattttaatttg
aagcctctcatcagtccagaaaaaattgacaccagcccactcactgttggttttggcacc
atcccaccaatttataagctttgcgttctgcctcgatcatag

DBGET integrated database retrieval system