KEGG   Monodelphis domestica (opossum): 100015831Help
Entry
100015831         CDS       T01031                                 

Definition
(RefSeq) arachidonate 12-lipoxygenase, 12S-type-like
  KO
K00458  
arachidonate 12-lipoxygenase [EC:1.13.11.31]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Arachidonic acid metabolism
Metabolic pathways
Antifolate resistance
Serotonergic synapse
Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    100015831
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    100015831
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100015831
 Human Diseases
  Drug resistance
   01523 Antifolate resistance
    100015831
Enzymes [BR:mdo01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.31  arachidonate 12-lipoxygenase
     100015831
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
2
AA seq 664 aa AA seqDB search
MGRYRVRVATGSFAFSGSTNQVQLWLVGQRAEAELGMQLRPTRGQMEDFEVDVSEDLGPL
LFVKLQKIHLFLKDAWFCNHITVWTFEKSMEKEIVFPCYRWVQGDGIICLPEATAWTMGK
DVQGLFQKHREEELEERRRLYRWATWKKGILLSVDAKSEKDLPLDVRFHENKKIDFEGTL
IAGMTEIALKRTYTLLSSWSSLEDFDQIFWCSKNTLAKKVRQSWKDDDFFGYQFLNGVNP
TVLRRSTSLPTRLVIPPGAEEIQIQLEKKLQEGCLFEADFSLLDGIQPNVIQGERQYLAA
PLVMFKMEHDGKLLPMAIQLQPPCSSSPVPPLFLPSDPSLTWLLAKAWVKNSDFQLHELQ
AHLLKTHLVAEVFAVATMRCLSGMHPIFKLLIPHLRYTLEINTRARTKLISDGGIFDQVV
NTGGGGHLEVLRRATACLTYRSLCPPDDLADRGLLGIPSALYVHDALRLWDIISRYVQGI
VHLHYSEDKVVQNDPELQNWCREITEIGLHGAQARGFPVSFQSRADLCYFLTMCIFTCTV
QHSGINQGQLDWYAWVPNAPCTMRQPPPTTKDVTLEMVMATLPNIQQACLQMTISWHLGR
FQPDMVPLGQHKEEYFSGPGPKAVLSFFQEELNTLEKEIVARNKNLDLPYEYLQPSRIEN
SITI
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgggtcggtacagagtacgtgtggccactgggagctttgccttctcggggtctaccaac
caggtgcagctgtggttggttgggcagcgtgcagaggctgaactggggatgcagctgcgg
cccactcgaggacagatggaggattttgaagtggatgtctctgaagacctggggcctctc
ttgtttgtgaagctacagaaaatccatctcttcctaaaggatgcctggttctgcaaccac
ataactgtttggacctttgagaagagcatggagaaggagatagtgttcccctgctacaga
tgggtgcagggagatggcatcatctgcctacctgaggctactgcttggacgatgggaaag
gatgtccaaggcctgtttcagaaacacagagaagaggagctggaggagagaaggagatta
tatcgctgggccacctggaagaaagggatactcttgtcagtggatgcaaaatcagagaaa
gacctacctctggatgtgagattccatgagaataagaagattgactttgaaggaacactg
attgcaggaatgactgagattgcccttaaacgcacgtacacccttctgagctcctggagt
agcttagaagattttgaccaaatcttctggtgcagcaagaataccctggctaaaaaggta
cgccagtcctggaaggatgatgatttttttggctaccaattcctcaatggggtcaacccc
acagtactgagaaggtctacctcactccccacacgacttgtgatccccccaggggcagaa
gagattcagattcagctggaaaaaaaactccaggagggctgcctctttgaagctgacttt
tccctgttggatggaatccagcccaatgtgatccagggggagagacagtacctagctgcc
cccctcgttatgtttaagatggagcatgatgggaagctcctacccatggccatccagctc
cagcctccctgctctagctctccagttccaccactcttcctgccctcagatccctccctc
acttggctcctggccaaggcttgggtcaaaaattctgacttccaactgcatgaactgcaa
gcacatctgctgaagacccatttggtggctgaagtgtttgctgtagccaccatgaggtgc
ctctcagggatgcaccccatcttcaagctcctgattcctcacctccgatatactctggag
attaacactcgtgcccggaccaaactcatttctgatggggggatttttgatcaggtggtg
aacactggtgggggaggtcacctggaagtcctccgcagggcaacagcctgtctgacctat
cgatccctctgccctcctgatgatctggctgacagagggcttctgggaattccatcagct
ctctatgtccatgatgccctcaggctatgggacattatctcccggtatgtgcaaggaata
gtccacctccattattcagaggacaaggttgtacagaatgaccctgaactacagaactgg
tgcagagagatcactgagattgggttacatggggcccaggcccgagggtttcctgtctcc
ttccagtccagggctgacctctgctactttctcaccatgtgcatcttcacatgcacagtc
caacactcaggcattaatcagggacagctagattggtatgcttgggttcctaatgctcca
tgtactatgaggcaacccccaccaactacaaaggatgtaacattggagatggtgatggct
acattgcctaatatccaacaggcctgtctccagatgactatttcatggcacctgggtcgg
ttccagccagacatggtgcccctgggtcagcataaggaagaatacttttcaggacctggg
cccaaagctgtgctgagttttttccaggaagaattgaacactctggaaaaagagattgtg
gcccgtaataagaatctagatctgccctatgagtacctgcagcccagcagaatagagaac
agcattaccatttaa

DBGET integrated database retrieval system