KEGG   Monodelphis domestica (opossum): 100015877Help
Entry
100015877         CDS       T01031                                 

Gene name
LAMC3
Definition
laminin, gamma 3
Orthology
K06247  
laminin, gamma 3
Organism
mdo  Monodelphis domestica (opossum)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Toxoplasmosis
Amoebiasis
Pathways in cancer
Small cell lung cancer
Class
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:mdo04151]
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:mdo04512]
Cellular Processes; Cell communication; Focal adhesion [PATH:mdo04510]
Human Diseases; Cancers; Pathways in cancer [PATH:mdo05200]
Human Diseases; Cancers; Small cell lung cancer [PATH:mdo05222]
Human Diseases; Infectious diseases; Amoebiasis [PATH:mdo05146]
Human Diseases; Infectious diseases; Toxoplasmosis [PATH:mdo05145]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 1585 aa AA seqDB search
MEEFLSLSLGLLLCLGLRLARGGMDACYDGQGHPQRCLPVFENAAFGRQVQVTNTCGSPP
EDYCLQMGAPGDTKLCHRCDARDPDHHHNASYLTDFHSQEESTWWQSQSMAFGVQYPNSV
NITLQLGKAYEITYVRLKFHTSRPESFAIYKRSQSGGPWVPYQYYSASCEKTYGKHEGQY
LRPGEDERVAFCTDEFSDISPLSGGNVAFSTLEGRPSAYSFDESPILQEWVTSTELLISL
NRLNTFGDDIFKDPKVLQSYYYAITDFSVGGRCKCNGHSSECVLNEGGQLVCSCQHNTTG
PDCEKCLPFYQDRPWARGTAEAANECLPCNCSGLSEECFYDWELYRSTGHGGHCQNCRDH
TSGPHCEHCQENFYRWDQKQPCQPCDCHPAGSLSLQCDNSGTCECKPSVTGWKCDRCLPG
FHSLNEGGCRPCTCNVAGSLGTCDSRNGRCPCKSKVEGYLCDRCQPGTFNLKPQNPSGCT
SCFCYGHSMVCAASLHYGIHYIISDFHQGAEDWKIRGPQGREEPAQWSQSGIFLEPKGEE
LWEFIAPEKFLGDQRFSYGQPLSLTFQVPPGGSLPSIWLKLEGAGLALTLKPSSPTGTQQ
PGQPEEYLFMFSLQETSEDTERLLPAFHFQRLLANLTALQIQVVGPRSSSSSRPTGQVIL
TKVQLTSAGPGLAPEAPWVEECTCPRGYLGQFCESCSPGYKRETPLGGPYASCVPCTCNQ
HGTCDPETGICQCLHQTEGPSCERCTPGFYGNPFLGQPDDCKPCPCPGQSACTTIPESGE
VVCTHCPKGQRGRLCEMCDDGFFGDPLGTSGPPQPCQRCQCNENVDPNAVGNCDPTTGHC
LRCLHNTTGAHCEQCQEGFYGSALAPHPADKCTPCSCDPKGSARDQGACDPQTGQCSCLP
HVTGRDCSHCSPGFYDLQPERGCQSCKCHPVGSQENQCHPETGQCPCLPGVGGVACTRCQ
PNFFGFSAKGCRACNCSPLGSVTTQCHENSTCICKPGFVGYKCDHCKENFFLTAQGSQCQ
ECPICFSLVKKEATKLKSKLKVMERWLQKSDCDNPWRDYALQGESPRGDTYQGQYLFLDT
REAFLEQMEELGSSMRAARHQLKAASKNVNCTRSSLEKSCIQLVDIETLLQSTELEIQQA
SGVLTTMVIPQEVPNQLTNWSHLATESQTLVKSHTDIATKIEAAARRALLASNTSYTLLW
SLVEGKEAQEIWHELEDRYQEMQKAQEELRTSTAQATTEAKSVLASVERISSEGAQHLVK
LSTPEILPPTHLTRDLDRKLQDVEKTLTAQESMFTEAAQDLLATSQEELQKIQPFEQLRE
GAKTALTLATSSKAKARTTISDSKNLLDNLEEMKKTFPQPKDQGALRRKARVIQDRLIGE
TQKKTKQAEKMLGNAASISATAKKKAKEAELLAKESTKNSKTLLRESKQEYRQASKLTNQ
ARGTLRDISRQVMLSRERRKEMEKVDWVRTGPGLSKVERNIQEARSSLEMDIKVLSVLLN
RLGKLDTHQALASALNESEQELEPLRQRLDRQGSLQEKLSLLQQEAEQQELQIQDLDSDL
KEIHADKQNLEDILRSLPEGCASWQ
NT seq 4758 nt NT seq  +upstreamnt  +downstreamnt
atggaagagtttctcagcctctctctgggcctcttgctctgcctggggctcaggctggcc
cgcgggggcatggatgcatgctatgatggccaaggacacccacagcgttgtctgcctgtg
tttgagaacgcagcgtttggccgccaggtccaggtgaccaacacatgtggcagcccaccc
gaagactactgcctccagatgggggcccctggagacaccaagctgtgccaccgctgtgat
gccagggacccggaccaccaccacaacgcctcctacctgaccgacttccacagccaggaa
gagagcacttggtggcagagccagtccatggcctttggggtccagtaccccaactcggtc
aacatcaccctacagctgggaaaagcttatgaaattacctacgtgaggctaaagttccac
accagtcgtcctgagagctttgccatctacaaacgcagccagtctggaggtccctgggtg
ccataccagtactacagcgcctcctgtgagaagacatatggcaagcatgagggccagtat
ctgaggccaggggaggacgagagggtggccttctgcactgatgagttcagcgacatctcc
ccactgagtggaggcaatgtagccttctccaccctagaaggtcggcccagtgcctatagc
tttgatgagagccccatcctgcaggaatgggtaaccagcacagagctgcttatttctctg
aaccggctcaacacctttggggatgacatctttaaggatcctaaagtattgcagtcctac
tattacgccatcactgacttctctgtcgggggcaggtgtaaatgtaacgggcattccagt
gaatgtgtcctcaatgaagggggccagctggtctgcagctgccagcacaacaccacgggc
cctgactgcgagaagtgcttacccttctaccaagaccggccctgggctcggggcacggcg
gaggctgccaatgaatgtctaccctgcaattgcagtggcctctctgaagaatgtttctat
gactgggagttgtaccggagcactgggcatggagggcactgccagaactgccgcgatcac
acctctggaccccactgtgagcattgccaggagaacttctaccgctgggaccagaagcag
ccatgccagccctgtgactgccatccagcaggatctctgagcctacagtgtgacaactca
ggcacctgtgagtgcaaacccagtgtgactggctggaagtgtgaccgctgtctgcctggg
ttccattctcttaatgaaggtggatgcagaccttgtacctgcaatgtggcgggcagctta
ggaacttgtgactcccgcaacggacggtgcccttgcaagtccaaggtggaaggctactta
tgtgacagatgccaacctgggacatttaacctgaagcctcaaaatccttctggttgcacc
agctgtttctgttatggccactccatggtgtgtgcagcttccctccattatggcatacac
tatatcatctctgacttccaccagggagcagaggattggaaaatcagaggtccgcaaggc
agagaggagcctgcacagtggagtcagagtggaatcttcttggagccaaagggagaggag
ctgtgggagttcattgcaccagagaaattccttggagatcagcgcttcagctatgggcag
cccctctctctgaccttccaagtaccacctgggggctctctcccctctatctggctgaaa
ttggaaggagcaggactagccctgactctgaaaccctccagtccaacaggcacccaacag
cctgggcagcctgaagagtacctgttcatgttcagcttacaggagacctcggaggataca
gaacgcctgctcccagcctttcacttccagaggctcttggccaacctgaccgcactccag
atccaggttgtgggtcccagaagcagcagcagcagccgccctacaggtcaagtgatcctg
actaaagtccagctcacttccgcaggccccggtctggcccccgaggccccttgggtggaa
gagtgtacatgtcccaggggctacctaggacagttctgtgaatcctgctctccaggatac
aagagggagacgcccttgggcgggccctatgccagttgtgtcccctgcacctgtaaccag
cacggcacctgcgaccccgaaacagggatctgccagtgcctgcaccaaaccgagggcccc
tcctgtgagcgctgcacacctggtttctacggcaacccctttttgggtcagccggatgac
tgcaagccctgtccctgtcctggccaatcagcatgtacgaccatcccagagagcggagag
gtggtgtgtacccactgccctaagggccaaagaggacgcctttgtgagatgtgtgatgat
ggcttttttggggaccccttggggacatctggtcccccccagccctgccagcgatgccag
tgtaatgagaatgtggaccccaatgctgtgggcaactgtgaccccacaacaggccactgt
ctacgctgtctgcacaatacaactggtgcccactgcgagcagtgccaggagggtttctac
gggagtgccctggccccacaccctgcggacaaatgcactccctgcagctgtgacccaaaa
ggctcagccagagatcagggggcctgtgacccccagacaggccagtgttcctgcctcccc
cacgtgactggacgggactgcagtcactgcagccctggtttctacgacctccagccagaa
aggggctgccagagctgcaagtgccatcctgttggttcccaggagaaccaatgccaccct
gaaactgggcagtgcccttgccttcctggggttggtggagtggcatgcacccgctgccaa
cccaatttcttcggcttctctgccaagggctgtcgagcctgtaactgttcccctttgggt
tctgtcaccacccagtgccacgagaacagcacctgtatatgtaagccaggctttgtgggc
tacaagtgtgatcactgcaaggagaactttttcctcacagctcagggctctcagtgccag
gagtgcccaatttgtttctcactagtgaagaaagaggccaccaaactcaagtctaagcta
aaggtgatggagcgatggctgcagaaatctgactgtgacaacccctggagggactatgcc
ttgcagggagaatcaccgagaggagacacctaccagggtcagtatctgtttctggacact
agggaagcttttctggagcaaatggaagagttggggagttccatgagagctgcccggcat
caattgaaggcagcaagcaagaatgtcaattgcaccaggagtagtttggagaagtcctgc
atccaactggtcgacattgagactctgctgcaatcaacagagctggagattcagcaggca
tctggagtcctcaccacaatggtaatccctcaggaagtgcccaaccagctcaccaattgg
agtcatctagctactgagtctcagaccctggtcaagagtcatacagacatagccaccaag
atagaggcagcagcacggagggctctgcttgcttccaataccagttatactcttctatgg
agtctcgtggagggcaaagaagcacaggagatatggcacgagctggaggacaggtaccag
gaaatgcagaaggcccaggaggagctcagaacatccacagcccaggcaaccactgaagcc
aagagtgtgctggcatctgtggagcggattagctcggagggggctcagcacctggtgaag
ctctccactccggaaattttgcctcccacacaccttaccagggacctggacaggaaacta
caggatgtggagaagacactgactgctcaagagagtatgttcaccgaagcagcccaggat
ctcttggccacttcccaggaagagcttcagaagatccagccctttgagcaactgcgagag
ggggctaagactgccctcaccctggctacctcatctaaagctaaagccagaacaaccatc
agtgattccaagaaccttttggacaatctggaagaaatgaagaaaacatttcctcagcca
aaggaccagggagctctaagaagaaaggcaagagtcattcaagatagactcattggtgaa
acccaaaagaagactaagcaagcagagaagatgctgggaaatgctgcttccatctctgcc
acagctaagaagaaggccaaggaagctgagttgttggctaaagagagtacaaagaattcc
aagaccttgctgagggaaagtaaacaggaataccgacaagccagcaaactgaccaaccaa
gcacgaggaactctccgagacatctcccggcaggtgatgttgtccagggaacgaaggaaa
gagatggagaaagttgactgggtaaggactgggcctgggttgagcaaggtggaaagaaac
atacaggaagcccggagctccctggagatggacatcaaggtcttgtctgtcctgcttaat
agattggggaagctggacacacaccaggctctagcctcagctctgaatgagtcagagcag
gagctggagccactgaggcagcgcctggacagacaggggtccctgcaagagaaactgagc
ctgctacaacaggaggcagagcagcaggagctccagatccaagacttggatagtgatctc
aaggagatccacgcggacaaacagaacctggaggacattctgcgcagcctgccggagggc
tgtgccagctggcagtga

DBGET integrated database retrieval system