KEGG   Monodelphis domestica (opossum): 100015877Help
Entry
100015877         CDS       T01031                                 

Gene name
LAMC3
Definition
(RefSeq) laminin subunit gamma 3
  KO
K06247  
laminin, gamma 3
Organism
mdo  Monodelphis domestica (opossum)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Toxoplasmosis
Amoebiasis
Pathways in cancer
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100015877 (LAMC3)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100015877 (LAMC3)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    100015877 (LAMC3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100015877 (LAMC3)
   05222 Small cell lung cancer
    100015877 (LAMC3)
  Infectious diseases
   05146 Amoebiasis
    100015877 (LAMC3)
   05145 Toxoplasmosis
    100015877 (LAMC3)
Cell adhesion molecules and their ligands [BR:mdo04516]
 1. Immunoglobulin Superfamily
  Others
   LU; Lutheran blood group glycoprotein [KO:K06578]
    Laminin-14 Extracellular matrix (ECM) components
     100015877 (LAMC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 1598 aa AA seqDB search
MEEFLSLSLGLLLCLGLRLARGGMDACYDGQGHPQRCLPVFENAAFGRQVQVTNTCGSPP
EDYCLQMGAPGDTKLCHRCDARDPDHHHNASYLTDFHSQEESTWWQSQSMAFGVQYPNSV
NITLQLGKAYEITYVRLKFHTSRPESFAIYKRSQSGGPWVPYQYYSASCEKTYGKHEGQY
LRPGEDERVAFCTDEFSDISPLSGGNVAFSTLEGRPSAYSFDESPILQEWVTSTELLISL
NRLNTFGDDIFKDPKVLQSYYYAITDFSVGGRCKCNGHSSECVLNEGGQLVCSCQHNTTG
PDCEKCLPFYQDRPWARGTAEAANECLPCNCSGLSEECFYDWELYRSTGHGGHCQNCRDH
TSGPHCEHCQENFYRWDQKQPCQPCDCHPAGSLSLQCDNSGTCECKPSVTGWKCDRCLPG
FHSLNEGGCRPCTCNVAGSLGTCDSRNGRCPCKSKVEGYLCDRCQPGTFNLKPQNPSGCT
SCFCYGHSMVCAASLHYGIHYIISDFHQGAEDWKIRGPQGREEPAQWSQSGIFLEPKGEE
LWEFIAPEKFLGDQRFSYGQPLSLTFQVPPGGSLPSIWLKLEGAGLALTLKPSSPTGTQQ
PGQPEEYLFMFSLQETSEDTERLLPAFHFQRLLANLTALQIQVVGPRSSSSSRPTGQVIL
TKVQLTSAGPGLAPEAPWVEECTCPRGYLGQFCESCSPGYKRETPLGGPYASCVPCTCNQ
HGTCDPETGICQCLHQTEGPSCERCTPGFYGNPFLGQPDDCKPCPCPGQSACTTIPESGE
VVCTHCPKGQRGRLCEMCDDGFFGDPLGTSGPPQPCQRCQCNENVDPNAVGNCDPTTGHC
LRCLHNTTGAHCEQCQEGFYGSALAPHPADKCTPCSCDPKGSARDQGACDPQTGQCSCLP
HVTGRDCSHCSPGFYDLQPERGCQSCKCHPVGSQENQCHPETGQCPCLPGVGGVACTRCQ
PNFFGFSAKGCRACNCSPLGSVTTQCHENSTCICKPGFVGYKCDHCKENFFLTAQGSQCQ
ECPICFSLVKKEATKLKSKLKVMERWLQKSDCDNPWRDYALQGESPRGDTYQDTREAFLE
QMEELGSSMRAARHQLKAASKNVNCTRSSLEKSCIQLVDIETLLQSTELEIQQASGVLTT
MVIPQEVPNQLTNWSHLATESQTLVKSHTDIATKIEAAARRALLASNTSYTLLWSLVEGK
EAQEIWHELEDRYQEMQKAQEELRTSTAQATTEAKSVLASVERISSEGAQHLVKLSTPEI
LPPTHLTRDLDRKLQDVEKTLTAQESMFTEAAQDLLATSQEELQKIQPFEQLREGAKTAL
TLATSSKAKARTTISDSKNLLDNLEEDIEVFIRTHQFERLWGSGEMKKTFPQPKDQGALR
RKARVIQDRLIGETQKKTKQAEKMLGNAASISATAKKKAKEAELLAKESTKNSKTLLRES
KQEYRQASKLTNQARGTLRDISRQVMLSRERRKEMEKVDWAGTGPGLSKVERNIQEARSS
LEMDIKVLSVLLNRLGKLDTHQALASALNESEQELEPLRQRLDRQGSLQEKLSLLQQEAE
QQELQIQDLDSDLKEIHADKQNLEDILRSLPEGCASWQ
NT seq 4797 nt NT seq  +upstreamnt  +downstreamnt
atggaagagtttctcagcctctctctgggcctcttgctctgcctggggctcaggctggcc
cgcgggggcatggatgcatgctatgatggccaaggacacccacagcgttgtctgcctgtg
tttgagaacgcagcgtttggccgccaggtccaggtgaccaacacatgtggcagcccaccc
gaagactactgcctccagatgggggcccctggagacaccaagctgtgccaccgctgtgat
gccagggacccggaccaccaccacaacgcctcctacctgaccgacttccacagccaggaa
gagagcacttggtggcagagccagtccatggcctttggggtccagtaccccaactcggtc
aacatcaccctacagctgggaaaagcttatgaaattacctacgtgaggctaaagttccac
accagtcgtcctgagagctttgccatctacaaacgcagccagtctggaggtccctgggtg
ccataccagtactacagcgcctcctgtgagaagacatatggcaagcatgagggccagtat
ctgaggccaggggaggacgagagggtggccttctgcactgatgagttcagcgacatctcc
ccactgagtggaggcaatgtagccttctccaccctagaaggtcggcccagtgcctatagc
tttgatgagagccccatcctgcaggaatgggtaaccagcacagagctgcttatttctctg
aaccggctcaacacctttggggatgacatctttaaggatcctaaagtattgcagtcctac
tattacgccatcactgacttctctgtcgggggcaggtgtaaatgtaacgggcattccagt
gaatgtgtcctcaatgaagggggccagctggtctgcagctgccagcacaacaccacgggc
cctgactgcgagaagtgcttacccttctaccaagaccggccctgggctcggggcacggcg
gaggctgccaatgaatgtctaccctgcaattgcagtggcctctctgaagaatgtttctat
gactgggagttgtaccggagcactgggcatggagggcactgccagaactgccgcgatcac
acctctggaccccactgtgagcattgccaggagaacttctaccgctgggaccagaagcag
ccatgccagccctgtgactgccatccagcaggatctctgagcctacagtgtgacaactca
ggcacctgtgagtgcaaacccagtgtgactggctggaagtgtgaccgctgtctgcctggg
ttccattctcttaatgaaggtggatgcagaccttgtacctgcaatgtggcgggcagctta
ggaacttgtgactcccgcaacggacggtgcccttgcaagtccaaggtggaaggctactta
tgtgacagatgccaacctgggacatttaacctgaagcctcaaaatccttctggttgcacc
agctgtttctgttatggccactccatggtgtgtgcagcttccctccattatggcatacac
tatatcatctctgacttccaccagggagcagaggattggaaaatcagaggtccgcaaggc
agagaggagcctgcacagtggagtcagagtggaatcttcttggagccaaagggagaggag
ctgtgggagttcattgcaccagagaaattccttggagatcagcgcttcagctatgggcag
cccctctctctgaccttccaagtaccacctgggggctctctcccctctatctggctgaaa
ttggaaggagcaggactagccctgactctgaaaccctccagtccaacaggcacccaacag
cctgggcagcctgaagagtacctgttcatgttcagcttacaggagacctcggaggataca
gaacgcctgctcccagcctttcacttccagaggctcttggccaacctgaccgcactccag
atccaggttgtgggtcccagaagcagcagcagcagccgccctacaggtcaagtgatcctg
actaaagtccagctcacttccgcaggccccggtctggcccccgaggccccttgggtggaa
gagtgtacatgtcccaggggctacctaggacagttctgtgaatcctgctctccaggatac
aagagggagacgcccttgggcgggccctatgccagttgtgtcccctgcacctgtaaccag
cacggcacctgcgaccccgaaacagggatctgccagtgcctgcaccaaaccgagggcccc
tcctgtgagcgctgcacacctggtttctacggcaacccctttttgggtcagccggatgac
tgcaagccctgtccctgtcctggccaatcagcatgtacgaccatcccagagagcggagag
gtggtgtgtacccactgccctaagggccaaagaggacgcctttgtgagatgtgtgatgat
ggcttttttggggaccccttggggacatctggtcccccccagccctgccagcgatgccag
tgtaatgagaatgtggaccccaatgctgtgggcaactgtgaccccacaacaggccactgt
ctacgctgtctgcacaatacaactggtgcccactgcgagcagtgccaggagggtttctac
gggagtgccctggccccacaccctgcggacaaatgcactccctgcagctgtgacccaaaa
ggctcagccagagatcagggggcctgtgacccccagacaggccagtgttcctgcctcccc
cacgtgactggacgggactgcagtcactgcagccctggtttctacgacctccagccagaa
aggggctgccagagctgcaagtgccatcctgttggttcccaggagaaccaatgccaccct
gaaactgggcagtgcccttgccttcctggggttggtggagtggcatgcacccgctgccaa
cccaatttcttcggcttctctgccaagggctgtcgagcctgtaactgttcccctttgggt
tctgtcaccacccagtgccacgagaacagcacctgtatatgtaagccaggctttgtgggc
tacaagtgtgatcactgcaaggagaactttttcctcacagctcagggctctcagtgccag
gagtgcccaatttgtttctcactagtgaagaaagaggccaccaaactcaagtctaagcta
aaggtgatggagcgatggctgcagaaatctgactgtgacaacccctggagggactatgcc
ttgcagggagaatcaccgagaggagacacctaccaggacactagggaagcttttctggag
caaatggaagagttggggagttccatgagagctgcccggcatcaattgaaggcagcaagc
aagaatgtcaattgcaccaggagtagtttggagaagtcctgcatccaactggtcgacatt
gagactctgctgcaatcaacagagctggagattcagcaggcatctggagtcctcaccaca
atggtaatccctcaggaagtgcccaaccagctcaccaattggagtcatctagctactgag
tctcagaccctggtcaagagtcatacagacatagccaccaagatagaggcagcagcacgg
agggctctgcttgcttccaataccagttatactcttctatggagtctcgtggagggcaaa
gaagcacaggagatatggcacgagctggaggacaggtaccaggaaatgcagaaggcccag
gaggagctcagaacatccacagcccaggcaaccactgaagccaagagtgtgctggcatct
gtggagcggattagctcggagggggctcagcacctggtgaagctctccactccggaaatt
ttgcctcccacacaccttaccagggacctggacaggaaactacaggatgtggagaagaca
ctgactgctcaagagagtatgttcaccgaagcagcccaggatctcttggccacttcccag
gaagagcttcagaagatccagccctttgagcaactgcgagagggggctaagactgccctc
accctggctacctcatctaaagctaaagccagaacaaccatcagtgattccaagaacctt
ttggacaatctggaagaggacattgaagtcttcatcaggacccaccaatttgaaagactt
tggggaagtggggaaatgaagaaaacatttcctcagccaaaggaccagggagctctaaga
agaaaggcaagagtcattcaagatagactcattggtgaaacccaaaagaagactaagcaa
gcagagaagatgctgggaaatgctgcttccatctctgccacagctaagaagaaggccaag
gaagctgagttgttggctaaagagagtacaaagaattccaagaccttgctgagggaaagt
aaacaggaataccgacaagccagcaaactgaccaaccaagcacgaggaactctccgagac
atctcccggcaggtgatgttgtccagggaacgaaggaaagagatggagaaagttgactgg
gcagggactgggcctgggttgagcaaggtggaaagaaacatacaggaagcccggagctcc
ctggagatggacatcaaggtcttgtctgtcctgcttaatagattggggaagctggacaca
caccaggctctagcctcagctctgaatgagtcagagcaggagctggagccactgaggcag
cgcctggacagacaggggtccctgcaagagaaactgagcctgctacaacaggaggcagag
cagcaggagctccagatccaagacttggatagtgatctcaaggagatccacgcggacaaa
cagaacctggaggacattctgcgcagcctgccggagggctgtgccagctggcagtga

DBGET integrated database retrieval system